(data stored in ACNUC7421 zone)

EMBL: CP001700.PE390

CP001700.PE390       Location/Qualifiers
FT   CDS_pept        complement(439201..439677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0393"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: mxa:MXAN_2836 Aha1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69345"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI9"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACU69345.1"
FT                   /translation="MTTQKIQIERTYPAAPEKIWELWTTAAGIESWWAPEGFDVHVETL
FT                   ELKPGGALVYTMTAVGPDQVAFMEQVGLPLSTTSTKAFTEVEPVRRLAYTSLADFIPGV
FT                   EPYDFLTEVELRPTADGGTHVVMTADAMHDEEWTGRLSAGRTNEMDNLGKVVGE"
     atgaccacgc agaagatcca gatcgagcgc acctaccccg ccgcccccga gaagatctgg        60
     gagctgtgga ccaccgccgc cggcatcgag agctggtggg cgccggaagg gttcgacgtc       120
     cacgtcgaga cgctggagct gaagcccggc ggcgcgctcg tctacacgat gaccgcggtc       180
     ggacccgacc aggtggcgtt catggagcag gtcggcctgc cgctgagcac gacctcgacc       240
     aaggccttca ccgaggtcga gccggtccgg cgcctggcgt acacctccct cgccgacttc       300
     atccccggcg tcgagccgta cgacttcctc accgaggtgg aactgcgccc gaccgccgac       360
     ggcggcacgc atgtcgtcat gacagccgac gccatgcacg acgaggaatg gaccggacgc       420
     ctgagcgccg gacggaccaa cgagatggac aacctcggca aagtggtcgg ggagtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page