(data stored in ACNUC7421 zone)

EMBL: CP001700.PE391

CP001700.PE391       Location/Qualifiers
FT   CDS_pept        complement(439714..441039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0394"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   saq:Sare_2937 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69346"
FT                   /db_xref="GOA:C7PVJ0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ0"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ACU69346.1"
FT                   /translation="MKARSCQVCGAALSDRGRGRTSVYCSAACRQRAYRLRHTTADQSA
FT                   ADVLAEIERQVRTLALRPPQSFRTDADALATTVRRLRRLAQNVTPEPVTKSAAEEQPPQ
FT                   LAGEPGFAALVEPHRKWLHLHCYRMAGSYDDAEDLVQETLLKAWRDRSGFEGRAAARTW
FT                   LYRIATNVCIDHLRRTGRRPQRYESTATSGAAEPPERMAWLQPYPDQLLDEAVAEDEHP
FT                   EAAAVSRETMELVFLATLQHLPPRQRAVLIFRDVLGRPAEETATLMDMSVAAANSALQR
FT                   ARQTLRERLPQRRTDWTRGDHSRQEQEIVRRYMAAAERSDVSMMADLLSADVLVTMPPN
FT                   PVWFAGRDALLTQIGPLFDRTSPGYFGRWRHLPVGANRLPAVAGYVQRPGTSVFRAQMV
FT                   DVLRIEAGQIMEITTFEAHLVAAFGLPLTLPMTDRPGARPTL"
     atgaaggcac ggagttgtca ggtctgcggt gccgcactgt cggatcgcgg acgcggccgg        60
     acctccgtct actgctcggc agcgtgccgc caacgcgcct accgcctccg gcacaccacc       120
     gccgaccaga gcgccgccga cgtcctcgcc gagatcgagc gccaggtcag gacgctcgcg       180
     ttgcgccctc cgcagtcctt ccgcaccgac gccgacgcgc tggcgacgac cgtgcgcagg       240
     ttgcggcgcc tggcccaaaa cgtcacaccg gaaccagtga cgaaatcagc cgccgaggaa       300
     cagccgcccc agctcgccgg cgaacccggc ttcgcagccc tcgtcgaacc ccaccgcaag       360
     tggctccacc tgcactgcta ccgcatggcc ggctcctacg acgacgccga ggacctggtc       420
     caggagaccc tcctcaaagc ctggcgcgac cgatccggct tcgagggcag ggcagcggcg       480
     cggacctggc tgtaccgtat cgccaccaac gtctgcatcg accacctgcg ccggaccggc       540
     cgccgtccgc agcgctacga gagcactgcc acctccggcg ccgccgagcc gccggaacgc       600
     atggcctggc tccagcccta ccccgaccag ctgctcgacg aggcggtcgc agaggacgaa       660
     caccccgagg cggccgcggt ctcgcgcgag accatggaac tggtcttcct cgccacgctc       720
     cagcacctgc cgcccaggca gcgcgcagtg ttgatcttcc gcgacgtgct gggccgcccg       780
     gcggaggaga ccgcgacgct gatggacatg agcgtcgccg ccgccaacag cgcgttgcag       840
     cgcgcccggc agacgctgcg cgaacgcctg ccgcagcggc gcaccgactg gacacgcggg       900
     gaccacagcc ggcaggaaca ggagatcgtg cgccgctaca tggccgccgc cgaacgctcc       960
     gacgtctcga tgatggccga cctgctcagc gccgacgtgc tggtcacgat gccgccgaac      1020
     ccggtgtggt tcgccgggcg ggacgcgctg ctcacccaga tcggacccct gttcgaccgc      1080
     acgtcgccgg gctacttcgg gcgctggcgg catctgccgg tcggcgcgaa ccggctgccg      1140
     gcggtcgccg gatacgtgca gcgaccaggc acgtcggtgt tccgggcgca gatggtcgac      1200
     gtgctgcgca tcgaagcggg gcagatcatg gagatcacca cgttcgaggc gcatctggtc      1260
     gccgcgttcg gtctgccgct gacgctgccg atgacggatc gccccggcgc gcgtccaact      1320
     ctttga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page