(data stored in ACNUC7421 zone)

EMBL: CP001700.PE392

CP001700.PE392       Location/Qualifiers
FT   CDS_pept        complement(441225..441893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69347"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ1"
FT                   /inference="similar to AA sequence:KEGG:SAV_696"
FT                   /protein_id="ACU69347.1"
FT                   /translation="MQKFETPSPVTVVLDIPAGQIRLVAGERADTVVEVLPSEASKRRD
FT                   AKAAAQTTVEFSGGVLRIATADPHKILGSSGSLDVTIALPAGSRIEGKAGAAELHSTGR
FT                   LGEVAFDGGYRSVELDEVAGARIKMHMGDVSIAKLTGPAQLRNGKGDITVAEAAGGAVD
FT                   LRTDMGDLKIAAAPGVSGTLDASSASGRITNALKNSEGAGAGLNIKATTSHGDIIATSL
FT                   "
     atgcagaagt tcgagacccc gagcccggtc accgtcgtcc tggacatccc ggcgggccag        60
     atccggctgg tcgccgggga gcgggccgac accgtcgtgg aggtgctgcc gtcggaggct       120
     tcgaagcggc gggacgccaa ggctgcggcg cagaccaccg tggagttcag cggcggggtg       180
     ctgcggatcg cgaccgccga cccgcacaag atcctgggca gctccgggtc gctggacgtg       240
     accatcgcgc tgccggccgg ctcgcggatc gagggcaagg ccggcgccgc ggaactgcac       300
     agcaccgggc ggctcggcga ggtggcgttc gacggcgggt accgctcggt cgagctggac       360
     gaggtcgccg gcgcgcgcat caagatgcac atgggggacg tctccatcgc caagctgacc       420
     ggtccggcgc agctgcgcaa cggcaagggc gacatcaccg tcgccgaggc cgccggcggc       480
     gcggtggacc tgcgcaccga catgggcgac ctgaagatcg ccgccgcccc cggcgtctcc       540
     gggaccctgg acgccagcag cgcctccggc cgcatcacca acgcgctgaa gaactccgaa       600
     ggcgccggcg ccggcctgaa catcaaggcc accacctcgc acggcgacat catcgccacc       660
     agcctgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page