(data stored in ACNUC7421 zone)

EMBL: CP001700.PE393

CP001700.PE393       Location/Qualifiers
FT   CDS_pept        complement(442044..442469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0396"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   sma:SAV_4279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69348"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ2"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ACU69348.1"
FT                   /translation="MSISLVQAEAVVAAARVGADERGVAVAFAVVDAGGNLVAFARGDG
FT                   ANLITVDTAIGKAFTAISIGADSINLTAAIQPGGPLFGTGLVLAGARSFVPYGGGVLIR
FT                   VDGRVVGALGIAGAASSEVDHEIAAAAAVQVPVRVAA"
     gtgagtatca gcttggtgca ggccgaggct gttgtcgctg ctgcgcgggt cggggccgat        60
     gagcggggtg tggccgtggc gttcgcggtg gtggacgcgg gtgggaacct tgttgcgttc       120
     gctcggggtg atggggcgaa tctcatcacc gtcgacaccg cgatcgggaa ggctttcacc       180
     gcgatcagta tcggtgctga cagcatcaat ctgaccgcgg ccattcagcc cggtgggccg       240
     ttgttcggga ccgggttggt gctggctggg gcgcggtcgt tcgttcctta tggcggcggc       300
     gtgcttattc gggtcgatgg acgggtggtg ggtgcgctgg ggatcgccgg ggcggcgagt       360
     tccgaggttg atcacgagat cgctgctgcg gctgccgtgc aggttccggt gcgggtcgcg       420
     gcgtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page