(data stored in ACNUC7421 zone)

EMBL: CP001700.PE394

CP001700.PE394       Location/Qualifiers
FT   CDS_pept        complement(442903..444330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0397"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_4; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sma:SAV_4421 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69349"
FT                   /db_xref="GOA:C7PVJ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ3"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACU69349.1"
FT                   /translation="MPLSGDGQQTQGQIGARLQEVRTRRGLTQRALAEPGYTAAYVSTL
FT                   EAGKARASEAALRYFAERLAISYEELATGVPAGLRAEIRDGLAEANAAMDAGRAAEAEA
FT                   LLAALLERAAGNDVPDLAADVRVALGAFLLRRGDLAAGREQFEQAEALLADRPLVARVR
FT                   AIRGRATAYYLEGDVRYSCYLLENTISELNGGGLPDPASLVLLYAAVIGPYLELGALER
FT                   ATKAATLALDLAPRVADPIAVATLHRSVARTLAAGGRFDEAEAALVKAQDVYQQWEIRA
FT                   ELAQCHWMRGYLYAQHERFADAETELRTAATMLRAADAVFYAVQVEVELADVRWRLGHT
FT                   DEAEHLLTRLLADLGPGHGAVHAAAAHRLLGLIRERADDPQTAERHYRQAIELQQDADV
FT                   AGDLADTSRLLGDLLDKQGRTREAVAAYRNGLTALARPGTTTLGAAPLPPPVISALDSV
FT                   HRAVHVVPGGGDSAAHE"
     atgcccctgt ccggcgacgg tcagcagacg cagggccaga tcggggcgcg gctgcaggag        60
     gtgcgcacgc ggcgcggcct gacgcagcgc gctttggcag agcccggata caccgcggcg       120
     tacgtctcca cgctggaggc cggcaaggcg cgcgcgtcgg aggcggcgct gcgttacttc       180
     gccgagcggc tcgcgatcag ctacgaggag ctggcgaccg gcgttccggc ggggctgcgt       240
     gcggagatcc gcgacgggct ggccgaggcg aacgcggcga tggacgcggg gcgcgcggcg       300
     gaggccgagg cgttgttggc ggcgctgctg gagcgggcgg cgggcaacga cgtgccggat       360
     ctggcggcgg atgtgcgcgt cgcgctcggg gcgttcctgc tgcgccgggg cgatctggcc       420
     gccgggcgcg agcagttcga gcaagccgag gcgctgctcg ccgatcggcc gctggtggca       480
     cgagtgcgcg cgattcgcgg tcgggcgacg gcgtactacc tggagggcga cgtccgctac       540
     tcctgctatc tgctcgagaa caccatcagc gagctgaacg gcggcgggct gccggatccg       600
     gcgtcgctgg tgctgctgta cgcggcggtc atcgggccgt atctggaact cggcgcgttg       660
     gagcgcgcca cgaaggcggc gacgctcgcc ctggacctgg caccgcgcgt cgccgatccg       720
     atcgccgtgg ccaccctgca ccgctcggtc gcccgcaccc tggccgccgg cggacgcttc       780
     gacgaagccg aggccgcgct ggtgaaggcg caggacgtct accagcaatg ggagatccgc       840
     gccgaactgg cgcaatgcca ctggatgcgc ggctacctct acgcccaaca cgaacgcttc       900
     gccgacgccg aaaccgaact gcgcaccgcc gcgaccatgc tccgcgccgc cgacgcggtg       960
     ttctacgcgg tccaggtcga agtcgaactc gccgacgtcc gctggcgcct cggccacacc      1020
     gacgaagccg agcacctgct gacccgcctg ctcgccgacc tcggcccagg ccacggcgcc      1080
     gtccacgctg ccgccgccca ccgcctcctc ggcctgatcc gcgaacgcgc cgacgacccc      1140
     caaaccgccg aacgccacta ccgccaagcg atcgaactcc agcaggacgc cgacgtcgca      1200
     ggcgacctcg ccgacacctc ccgcctcctc ggcgacctgc tcgacaagca gggccgcacc      1260
     cgcgaggcgg tggcggccta ccggaacgga ctgaccgcgc tagcgaggcc cggcacgacg      1320
     accctcggcg ccgcaccgct gccgccgccg gtgatctcgg cactggattc ggtgcatcgg      1380
     gcggtgcatg tcgtgccggg tggtggggat tcggccgctc acgaatag                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page