(data stored in ACNUC7421 zone)

EMBL: CP001700.PE395

CP001700.PE395       Location/Qualifiers
FT   CDS_pept        444478..445764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0398"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_7423 prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69350"
FT                   /db_xref="GOA:C7PVJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69350.1"
FT                   /translation="MPPAIRQTDHLFTVPLHHDRPRGEQIELYAREVTADETLPWLVFL
FT                   QGGPGHRSPRPLPAALATGWLSRALQDYRVLLLDQRGTGRSTPATRQTLPSRGDARRQA
FT                   EYLTAFRADSIVRDAELVRRQLTGGAPWSVLGQSFGGFCTISYLSDAPEGLAEVFITGG
FT                   VPTLEGDADDVYRAAYPRMEDKNALLYHRYPQDVDIARSIAEFLREHETVLPDGTLLTV
FT                   EAFQSLGIMLGATDGVDRLHYLLEDPFCQTAHRTELSDRFQWQVQAALSFAERPLYALL
FT                   HEAIYAQGSGPTAWAASRVRKQFPRFDAERVLSETGTPLLFTGETIHPWHFRTDPALRP
FT                   LRAVADLLAGYEDWRPLYDTSVLAANTVPTFATVYTDDLYVDPKQSLTTADAIRALTVH
FT                   VSDDHEHDGLTASGTDVLDHLLGMARDAR"
     gtgccaccgg cgatccggca gaccgaccac ctgttcacgg ttccgctgca ccacgaccgt        60
     ccgcgcgggg agcagatcga gctctacgcc cgcgaggtca ccgcggacga gacgctcccg       120
     tggctggtct tcctccaggg cgggcccggc caccggtcgc cccgcccgct ccccgcggcg       180
     ctggcgaccg gctggctcag ccgcgccctg caggactacc gcgtgctgct gctcgaccag       240
     cgcggcaccg gccgctcaac cccggcgacg cggcagaccc tgccgagccg gggcgacgcg       300
     cggcgccagg ccgagtacct caccgccttc cgcgccgact cgatcgtccg cgacgccgag       360
     ctcgtccggc ggcagctgac cggcggcgct ccgtggagcg tgctggggca gagcttcggc       420
     ggattctgca cgatcagcta tttgtcggac gcgcccgaag gcctcgcaga ggtcttcatc       480
     accggcggcg tgccgacgtt ggagggcgac gccgacgacg tctaccgtgc tgcctatccg       540
     cgcatggaag acaagaacgc gctgctctac caccgctatc cccaggatgt ggatatcgcg       600
     cgctcgatcg ccgagttcct gcgggagcac gaaaccgtgc tgcccgacgg gacgctgctg       660
     acggtcgagg cgttccagtc gctcggcatc atgctcggcg cgaccgacgg tgtggaccgt       720
     ctgcactacc tcctggagga ccccttctgc cagacggcgc accggacgga gctgtccgac       780
     cggttccagt ggcaggtcca ggccgcactg tccttcgccg agcggccgct ctacgcgctc       840
     ctgcacgagg cgatctacgc gcagggttcc ggacccaccg cgtgggctgc cagccgcgtt       900
     cgcaaacagt tcccgcgctt cgacgccgag cgcgttctgt cggagacggg aacaccgctg       960
     ctgttcacgg gcgagaccat tcacccctgg cacttccgga ccgacccggc gctgcggccg      1020
     ctgcgcgcgg tggccgatct gcttgccggc tatgaggatt ggcgcccttt gtacgacacg      1080
     tccgtgctgg cggcgaatac cgtgccgacc ttcgcgactg tctataccga cgacctgtac      1140
     gtcgatccca agcagtcgct gaccaccgcc gacgccatcc gggctctgac ggttcacgtc      1200
     tcggacgacc acgagcacga cggcctcacc gcaagcggca ccgacgtgct cgaccacctg      1260
     ctgggtatgg cgcgcgacgc gcgctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page