(data stored in ACNUC7421 zone)

EMBL: CP001700.PE396

CP001700.PE396       Location/Qualifiers
FT   CDS_pept        445809..446606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0399"
FT                   /product="protein of unknown function DUF239"
FT                   /note="PFAM: protein of unknown function DUF239; KEGG:
FT                   gvi:gll1344 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69351"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ5"
FT                   /inference="protein motif:PFAM:PF03080"
FT                   /protein_id="ACU69351.1"
FT                   /translation="MPAQALRALLGNLRTRIAAAAVSAAALGAVVVLPASSAHAAQCWY
FT                   GSCFSYVTGRQYTNTTGASVTMEQAAPRNVAADGHSLQELSLQTSGGTTVADTIEIGWT
FT                   VDPELNGDYQPHLFVFHWVDGQPTCYNACGFVQVSTTVRAGMAVTPGTTGVFALRYYQG
FT                   NWWAYYNNVAFGYFPGSAWKGAFTSAQIVSAFGEVASDSAPSCTQMGDGIYGSQSGASS
FT                   ISGYQLYGSTDRPALTVTATDPGSYNYGAVTGTSFNLGGPGAC"
     atgcctgctc aagccttgcg cgctctgctc ggcaatctca gaacccgaat agcggcggcg        60
     gctgtgtccg ccgctgccct cggcgccgtc gtcgtcctgc ccgccagcag cgcgcacgcc       120
     gcgcagtgct ggtacggatc ctgcttcagc tacgtcaccg gacgtcagta cacgaacacg       180
     accggcgcgt cggtcaccat ggagcaggcc gccccgcgca acgtcgccgc cgacggtcac       240
     tcactgcagg aactctcgct ccagacctcc ggcgggacga ccgtcgccga caccatcgag       300
     atcggctgga ccgtcgaccc cgaactcaac ggcgactacc agccgcacct gttcgtcttc       360
     cactgggtcg acggccagcc gacgtgctac aacgcctgcg gcttcgtcca ggtctccacg       420
     acggtgcgag ccggcatggc cgtgacaccg ggtaccaccg gcgttttcgc tctgcgctac       480
     taccagggca actggtgggc gtactacaac aacgtcgcct tcgggtactt ccccggctcg       540
     gcatggaagg gcgccttcac cagcgcccag atcgtctcgg cgttcggcga ggtggcatcc       600
     gacagcgcgc cgagctgcac gcagatgggg gacgggatct acgggagcca gagcggagcg       660
     tcttcgattt ccggttacca gctctacgga tccactgacc ggccggcgct gacggtgacg       720
     gcgaccgacc cgggctcgta caactacggc gcggtcacgg ggacctcgtt caatctggga       780
     ggtcctggtg cttgctaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page