(data stored in ACNUC7421 zone)

EMBL: CP001700.PE397

CP001700.PE397       Location/Qualifiers
FT   CDS_pept        446596..447435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0400"
FT                   /product="protein of unknown function DUF239"
FT                   /note="PFAM: protein of unknown function DUF239; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69352"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ6"
FT                   /inference="protein motif:PFAM:PF03080"
FT                   /protein_id="ACU69352.1"
FT                   /translation="MLAKVRVGLVSGLFSMSLLGSTAAAAVPAASAAVLAPRVPTVSAA
FT                   ATDSGPICWYGACYDYVSGHQWTDTTGVSVLMKVEKPVVNPAQTGEHSLQEIALQNTAR
FT                   TSTVEIGWTVDPELNGDNQPHLFVYHWVDGQESCYNACGFVQVSRAIKPGMALHPNEAA
FT                   NFATQNIHGDWWVFFRDEPVGYFPGSLWSGTYQTAQLVSVFGEVAENTADSPSCTQMGD
FT                   GRFGSSPAASWIRDYRIAGTKDAPNLAVSSTSPNHYDAGAVTPTSFKLGGPGTGACS"
     gtgcttgcta aggtccgcgt cgggctcgtt tcgggcctgt tctccatgag cctgctcggt        60
     tccacggctg ctgccgcggt cccggcggcg tcggctgccg tgctggcgcc gcgcgtgccg       120
     acagtgtccg ccgccgctac ggacagcggc ccgatctgtt ggtacggcgc gtgttacgac       180
     tacgtcagcg gtcatcagtg gacggacacc accggcgtca gtgtcctgat gaaggtcgag       240
     aagccggtcg tgaaccccgc ccagaccggg gaacacagcc tgcaggagat cgcactgcag       300
     aacaccgccc gcacctcgac cgtcgagatc ggctggacgg tcgatcccga actcaacggc       360
     gacaaccagc cgcacctgtt cgtctaccac tgggtcgacg gccaagagag ctgctacaac       420
     gcctgcggct tcgtgcaggt ctcccgcgcc atcaagcccg gcatggccct gcacccgaac       480
     gaggcggcga acttcgccac ccagaacatc cacggcgact ggtgggtctt cttccgtgac       540
     gagcccgtcg gctacttccc cggctcgctg tggagcggca cgtaccaaac agcgcagctg       600
     gtctcggtct tcggcgaggt ggcggagaac accgcggact cgccgagctg tacacaaatg       660
     ggtgacggac gcttcggctc ctcgcccgcc gcatcctgga tccgcgacta ccgcatcgcc       720
     gggaccaagg acgcaccgaa cctcgccgtc agctccacca gtccgaatca ctacgacgcc       780
     ggagccgtga cgccgacgtc gttcaagcta ggcggaccgg ggaccggcgc ttgtagctaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page