(data stored in ACNUC7421 zone)

EMBL: CP001700.PE398

CP001700.PE398       Location/Qualifiers
FT   CDS_pept        complement(447462..448199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0401"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_4255
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69353"
FT                   /db_xref="GOA:C7PVJ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69353.1"
FT                   /translation="MTNAKTEMAKPQVAAPAAPRPLRRDAERNRQLIIDTAKTVFAARG
FT                   LDASLDEVAHEAGLGVGTVYRRFPNRDALIDALFDDMLASITRIVAESMALPRAWDGLV
FT                   HFMTAMLESQGRDKALRDLMLSRQKYLDQCELDREEVVRETVQPALYDIIGRAKAEGDL
FT                   RPDVVPADVGVLLISAVGVVDFTAPADPEVWRRHLAVLLDGLRARAAGDTTVLAPAPLD
FT                   DEQLDLCMSGWKYGTRETPRRRS"
     gtgacgaacg cgaagaccga gatggcgaag ccccaggtgg cagccccggc tgcgccccgt        60
     ccgctgcgcc gggacgccga gcggaaccgg cagttgatca tcgacaccgc caagacggtc       120
     ttcgcggcac gcggtctgga cgcgtccctc gatgaggtgg cgcacgaagc cggcctgggc       180
     gtcggaaccg tctaccgccg cttccccaac cgcgacgcgc tcatcgacgc gctgttcgac       240
     gacatgctcg cctcgatcac gcgcatcgtc gcggagtcga tggcgctgcc gcgcgcctgg       300
     gacgggctgg tccacttcat gaccgcgatg ctggagtcgc agggccgcga caaggcgctg       360
     cgggacctga tgctctcgcg gcagaagtac ctcgaccagt gcgagctgga cagggaggag       420
     gtcgtgcggg agaccgtgca gccggcgctg tacgacatca tcggtcgggc caaggcggag       480
     ggcgacctgc gccccgacgt ggttccggcc gatgtgggcg tgctgttgat ctcggctgtc       540
     ggggtcgtcg acttcacggc tcccgccgat cccgaggtgt ggcggcgcca tctggcggtg       600
     ctgctggacg gcttgcgcgc ccgcgccgcc ggggacacga cggtcctcgc cccggcgccg       660
     ctggacgacg agcagctcga tctttgtatg agcggctgga agtacgggac gcgggagacg       720
     ccgcgtcggc gttcttag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page