(data stored in ACNUC7421 zone)

EMBL: CP001700.PE399

CP001700.PE399       Location/Qualifiers
FT   CDS_pept        448361..449890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0402"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_7490 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69354"
FT                   /db_xref="GOA:C7PVJ8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69354.1"
FT                   /translation="MADLRTTGAEAQTADAAPADHTDHTDPHHARRWFILGIIGLAQLM
FT                   IVLDVTIVNIALPDAQKALGFSNGDRQWIVTAYSLAFGSLLLLFGRVSDVIGRRAMFLI
FT                   GLVGFAAASALGGAAPNFEILVLARALQGVAGAMLAPAALSLLSTTFTEAKERATAFAV
FT                   FGGIAGSGAAIGMLLGGVLTEFLNWRWTLFVNVGISVIAIAGAAVLIPRHARSADRPSL
FT                   DIPGTVLVSAGLFGIVYGFANAESHPWSAPGTWGFLVAGLVLLGAFTFWQTRTKHPLLP
FT                   LRVILERNRGGSYLAMFLTGIGMFGVFLFLNYYLQEILRYSPVMTGVAFLPMVAALMIT
FT                   ATISTTQLYPRVGAKILVFAGMLLAGAGMVWLTGISLTSSYAANILGPTVVVGIGMGAI
FT                   FAPAMNAATSGVEAGDAGVASAMVNTAQQIGGSIGTALLNSLAASALTSYLVGKNATNP
FT                   VVQANAAIHSYVVAFWWAAAIFGVGAIICGLILKSGKPDPADPDAAPAIHA"
     atggcagatc ttcggacgac cggcgcggag gctcagaccg ccgacgccgc acccgccgac        60
     cacaccgacc acaccgaccc ccaccacgcc aggcgctggt tcatcctggg gatcatcggc       120
     ctggcgcagt tgatgatcgt gctcgacgtg acgatcgtga acatcgcgct gccggacgcc       180
     cagaaggcgc tgggcttctc gaacggcgac cggcagtgga tcgtcaccgc ctactccctg       240
     gccttcggca gcctgctgct gctgttcgga cgggtgtccg acgtcatcgg ccgccgcgcg       300
     atgttcctga tcggcctggt cggcttcgcc gcggcctccg cgctgggcgg cgccgcgccg       360
     aacttcgaga tcctggtcct ggcccgcgcg ctgcagggcg tcgccggcgc catgctcgcc       420
     ccggccgcgc tgtcgctgct gtccacgacc ttcaccgagg ccaaggagcg cgccaccgcc       480
     ttcgccgtgt tcggcggcat cgccggctcc ggcgccgcga tcggcatgct gctcggcggc       540
     gtgctgaccg agttcctgaa ctggcgctgg acgctgttcg tcaacgtcgg catcagcgtt       600
     atcgcgatcg ccggcgccgc cgtcctgatc ccgcgccacg cgcgcagcgc cgaccggccc       660
     tcgctcgaca tccccggcac ggtcctggtc tcggcgggcc tgttcggcat cgtctacggc       720
     ttcgccaacg ccgaatcgca tccgtggagc gccccgggga cctggggctt cctggtcgcc       780
     ggcctggtcc tgctgggcgc gttcaccttc tggcagaccc gcaccaagca cccgctgctc       840
     ccgctgcgcg tcatcctcga gcgcaaccgc ggcggctcct acctggcgat gttcctcacc       900
     ggcatcggca tgttcggcgt gttcctgttc ctgaactact acctgcagga gatcctgcgc       960
     tactccccgg tgatgaccgg cgtggcgttc ctgccgatgg tcgccgccct gatgatcacc      1020
     gcgacgatca gcaccaccca gctctacccg cgcgtcggcg ccaagatcct ggtcttcgcc      1080
     ggcatgctgc tggccggcgc cggcatggtc tggctcaccg gcatcagcct gacctccagc      1140
     tacgcggcga acatcctcgg cccgaccgtg gtcgtcggca tcggcatggg cgccatcttc      1200
     gccccggcga tgaacgccgc cacctccggc gtcgaggccg gcgacgccgg cgtcgcctcg      1260
     gcgatggtga acaccgcgca gcagatcggc ggctcgatcg gcaccgcgct gctgaactcc      1320
     ctcgccgcca gcgcgctgac cagctacctg gtcggcaaga acgccacgaa cccggtcgtg      1380
     caggccaacg cggcgatcca cagctacgtg gtcgcgttct ggtgggccgc ggccatcttc      1440
     ggagtcggcg cgatcatctg cggcctgatt ctgaagtcgg gcaagccgga tccggcggac      1500
     ccggacgccg ctccggcgat ccacgcctag                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page