(data stored in ACNUC7421 zone)

EMBL: CP001700.PE4

CP001700.PE4         Location/Qualifiers
FT   CDS_pept        4998..6143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV_4319 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68959"
FT                   /db_xref="GOA:C7QFM0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACU68959.1"
FT                   /translation="MRVTHLSLADFRSYASLDVALGGGVTAFVGPNGQGKTNLVEAIGY
FT                   IATLDSHRVATDQPLVRFGAPRAIVRANVEREGRTQLVEIELNPGGANRARLNRNPVPR
FT                   PREVLGVLRTVLFAPEDLALVKGDPGERRRFLDELLVARWPRFAGVRADYDRVLKQRNT
FT                   LLRTAAMARRNKASGPNISTLDAWDHHLALAGAELVAARLALISALSPLVDKCYVEIAE
FT                   GGQTRIGYRSTISAEPDPTAAALTEQFMTALGEARANELDRGITLVGPHRDEMVLELTS
FT                   SSGDNMPARGYASHGESWSYALALRLAAYDLLRSDGSDGGEPVLILDDVFAELDAKRRR
FT                   RLAERVSGADQVLITAAVDADVPEQLIGQKFTVADGQVSAA"
     ttgcgggtca cgcatctgtc cctggcggat ttccgctcct acgcctccct cgacgtcgcg        60
     ctcgggggag gcgtcacggc gttcgtcggg cccaacgggc aggggaagac caacctggtc       120
     gaggcgatcg gctacatcgc cacgctcgac agccaccgcg tggccaccga ccagccgctc       180
     gtgcgcttcg gcgcgccgcg cgccatagtg cgcgcgaacg tggagcgcga aggccgtaca       240
     cagcttgtgg aaatcgagct gaacccgggc ggggcgaacc gcgcgcggct caaccgcaac       300
     ccggttccgc gcccgcgcga ggtgctcggc gtgctgcgga ccgtgctgtt cgccccagaa       360
     gacctcgcct tggtgaaggg cgatccgggg gagcgccgcc ggttcctgga cgaactgctc       420
     gtcgcccgct ggccgcggtt cgccggggtc cgtgccgact acgacagagt gctgaagcag       480
     cggaacactt tgctgcgcac ggccgcgatg gcgcggcgta acaaggcctc cggtcccaac       540
     atctcgacgc tcgacgcctg ggaccaccac ctggcgctgg ccggcgccga actggtcgcc       600
     gcgcgcctgg cgctgatctc ggcgttgtcc ccccttgtgg acaagtgtta cgtcgagatc       660
     gccgagggcg gccagacgcg catcggctac cgctcgacga tctccgccga gcccgatccg       720
     accgccgcgg ccctgacaga acagttcatg accgccctcg gcgaggcccg cgctaacgaa       780
     ttggaccgcg gcatcaccct ggtcggtccg caccgcgacg aaatggtgct ggagctgacc       840
     tcctcttccg gagacaacat gccggcgcgc ggctacgcca gccacggcga atcctggtcg       900
     tacgcgctgg cattacgttt ggccgcatac gacctgctgc gctccgacgg gtccgacggc       960
     ggcgagccgg tcctgatcct cgacgacgtc ttcgccgaac tcgacgccaa gcgccgccgc      1020
     cggctggccg agcgtgtctc gggcgccgac caggtgctca tcaccgcggc cgtggacgcc      1080
     gacgtgccgg agcagctgat cggccagaag ttcacggtcg ccgacggaca ggtgagcgcg      1140
     gcgtga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page