(data stored in ACNUC7421 zone)

EMBL: CP001700.PE40

CP001700.PE40        Location/Qualifiers
FT   CDS_pept        complement(43286..43444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68995"
FT                   /db_xref="GOA:C7QFQ6"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ6"
FT                   /inference="similar to AA sequence:KEGG:SCO3852"
FT                   /protein_id="ACU68995.1"
FT                   /translation="MYAFVWRHLPGPVSVKILIALAIAALIVVLLFGWVFPWIEPLMPF
FT                   SGNTVSQ"
     atgtacgcat ttgtgtggcg gcaccttcca gggcccgtct ccgtgaagat cctcatcgct        60
     ctggccatcg ccgccctgat cgtggtgctc ctgttcggct gggtcttccc gtggatcgag       120
     ccgttgatgc cgttcagcgg caacacggtg tcgcaatag                              159
//

If you have problems or comments...

PBIL Back to PBIL home page