(data stored in ACNUC7421 zone)

EMBL: CP001700.PE400

CP001700.PE400       Location/Qualifiers
FT   CDS_pept        complement(449980..450621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0403"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3956
FT                   TetR family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69355"
FT                   /db_xref="GOA:C7PVJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69355.1"
FT                   /translation="MPSTLSTDDREVEGTLDFVRLTDMAPARTLRADAARNREKLLSAA
FT                   TRLFAERGLDVPMEHIARTAGVSIGTLYAHFPTRVALFEAIFPTRLAALQELGRKALAE
FT                   PDAWQAFVGYLQDVFAMHAEDHGLNEVLARDIPDAAGVVQSCRQGAGHAAELIDRAHAD
FT                   GRLRADFTITDMSTLTRAMTRVIRDSINGGTDEWRRFLGIYIDGLRAENP"
     gtgccctcga ctttatccac ggacgaccgt gaagtcgagg gcaccctcga tttcgttaga        60
     ctgacagaca tggcaccggc ccgaaccctc cgcgcggacg cggcgcgcaa ccgtgagaag       120
     ctgctgtccg cggccacgcg gctgttcgcc gaacgcgggc tggacgtgcc gatggaacac       180
     atcgcgcgta ccgccggagt cagcatcggc acgctgtacg cgcacttccc gacgcgcgtc       240
     gcgctcttcg aggcgatctt cccgacacgg ctggcggcgc tccaggaact cggccgcaag       300
     gcactggccg aacccgacgc ctggcaggcc ttcgtcggct atctccagga cgtgttcgcg       360
     atgcacgccg aggaccacgg cctgaacgag gtgctggccc gcgacatccc cgacgccgcc       420
     ggtgtcgtgc agtcatgccg gcagggcgcg gggcacgccg ccgagctgat cgaccgcgcc       480
     cacgccgacg gccgactgcg cgccgacttc acgatcaccg acatgtccac actgacgcgc       540
     gcgatgacac gggtcatccg ggactcgatc aacggcggca cggacgagtg gcgccgattc       600
     ttggggattt acatcgacgg gctgcgcgcc gagaacccat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page