(data stored in ACNUC7421 zone)

EMBL: CP001700.PE401

CP001700.PE401       Location/Qualifiers
FT   CDS_pept        450664..451374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0404"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: fal:FRAAL2466 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69356"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69356.1"
FT                   /translation="MPTAVVIGVGPGLGMSIARRFGGAGHSVALVSRSDARHADYLAEL
FT                   ASAGIESEAFVADVNDREQVGSVVDAIEAKHGIDVLYYGPGASDVSQPAPITETTADEV
FT                   RASMGVVYAAVDIVGRVLPGMMARGRGGLLFAGGLSAVVPVPSLGALAVTSAALRNYAL
FT                   TLNAGLADTGVYAGTLIIGGLIERGDIHGFVVAHPEMFGHVPLRTLNPDDIAAAAWEMY
FT                   AARDRAEETFSVLS"
     atgcccactg ctgtcgtcat cggtgtaggt cctggccttg gcatgtccat agcccggcgt        60
     ttcggcggcg ccggccactc ggtcgcgctc gtctcgcgat cggacgcccg gcacgccgac       120
     tatctggctg agctggcttc ggcggggatc gagagcgagg cgttcgtcgc cgacgtcaac       180
     gaccgggagc aggtgggctc ggtcgtggac gcgatcgagg cgaagcacgg catcgacgtc       240
     ctctactacg gcccgggcgc cagtgacgtc tcgcagcccg cgccgatcac cgagacgacc       300
     gcagacgagg tccgcgcgtc gatgggtgtc gtgtacgccg cagtcgacat cgtcggtcgg       360
     gtactcccgg gcatgatggc gcgcggccgc ggcgggctgc tgttcgccgg cggcctcagc       420
     gctgtggtgc cggttccttc cctcggcgcc ctcgccgtca cctcggctgc tttgcgcaac       480
     tacgccctga ctctcaacgc gggcctggcg gacaccggcg tctacgccgg cacgctcatc       540
     atcggcgggc tcatcgagcg cggggacatc cacggcttcg tcgtggcgca cccggagatg       600
     ttcgggcacg tgccgttgcg aacgctgaat ccggacgaca tcgccgccgc cgcgtgggag       660
     atgtacgccg ctcgcgaccg tgccgaggag accttcagtg tcctgagttg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page