(data stored in ACNUC7421 zone)

EMBL: CP001700.PE402

CP001700.PE402       Location/Qualifiers
FT   CDS_pept        complement(451736..452164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0405"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="KEGG: sen:SACE_3470 dual specificity protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69357"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK1"
FT                   /inference="similar to AA sequence:KEGG:SACE_3470"
FT                   /protein_id="ACU69357.1"
FT                   /translation="MAELWDPAADGVLHLPSGRLIRGRGLSRPMPDGPAPSFAVYLLGK
FT                   QPPDVSWESRWVRWPDFRLPADRAAARECFVEAWQRCETERVEVACAGGRGRTGTALAC
FT                   IAVLDGVAPDAAVAYVREHYSPHAVETPWQRRFVAAFR"
     atggcagagc tctgggatcc ggccgcggac ggtgtgctcc acctcccctc cggtcggctg        60
     atccgcggcc gtggcttgag ccgtccgatg cccgacggtc cggcgccgag cttcgcggtg       120
     tacctgctcg gcaagcagcc gccggacgtc tcgtgggaga gccgctgggt ccgctggccc       180
     gacttccgtc ttccggcgga tcgggcggcg gcgcgcgagt gtttcgtgga ggcttggcag       240
     cgctgcgaga ccgaacgcgt cgaggtcgcg tgcgccggcg gtcgtggacg tacagggacg       300
     gcactggcgt gtatcgcagt actcgacggc gtcgcgcctg atgccgcagt cgcttacgtg       360
     cgggagcact actcgccgca tgccgtggag acgccctggc aacggcggtt cgtggcggcc       420
     ttccggtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page