(data stored in ACNUC7421 zone)

EMBL: CP001700.PE403

CP001700.PE403       Location/Qualifiers
FT   CDS_pept        complement(452188..452937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0406"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: gdj:Gdia_2872
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69358"
FT                   /db_xref="GOA:C7PVK2"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK2"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACU69358.1"
FT                   /translation="MSASILWEEPTGQGWTQVGELTTALVLSSAIGLEREIRQKAAGLR
FT                   TYTIIGLGAALFMLVSKYGFTDVLRPGLVQLDPSRVAAQIVSGLGFIGGGVIFMRRDSV
FT                   RGLTTAAAMWLTAGVGAAAGAGLGLLALLTTVAYFVVCYGLRPLTHWMPALRTPPVTYR
FT                   IEYQDGRGLLRTILDICTGAGFFVASFSGTGHDERDAQREPGAHPHTVEVVLTLHGRGN
FT                   ANALTEQLVDTSGIVAVAYNHEDDEFT"
     atgagcgcat cgatcttgtg ggaggaaccg accgggcagg gctggacgca ggtcggagag        60
     ctgacgacgg ccctggtgct gtcctcggcg atcgggctgg aacgcgagat ccggcagaag       120
     gccgcgggct tgcgcaccta cacgatcatc ggcctgggag ccgcgctgtt catgctggtg       180
     agcaagtacg gcttcacgga cgtgctgcgc ccgggactgg tccagctcga cccctcgcgg       240
     gtcgcggcgc agatcgtctc cggactcggc ttcatcggcg gcggcgtgat cttcatgcgc       300
     cgcgacagcg tccgcggcct gaccaccgcg gccgcgatgt ggttgaccgc cggcgtcggc       360
     gcggcggcgg gcgccggcct gggactgctg gcgttgctca cgacggtcgc gtatttcgtg       420
     gtgtgctacg gattgcgccc gctgacccac tggatgcccg cactgcgcac gccgccggtg       480
     acctaccgca tcgagtacca ggacggcaga gggttactcc gcaccatcct cgacatctgc       540
     accggcgccg gcttcttcgt cgcctccttc agcggcacgg gacacgacga gcgggacgcc       600
     cagcgcgagc ccggcgcgca tccgcacacg gtcgaggtcg tgctcacgct gcacggccgc       660
     ggcaacgcca acgcgctgac cgagcagttg gtcgacacct cggggatcgt cgcggtcgcg       720
     tacaaccacg aagacgacga gttcacatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page