(data stored in ACNUC7421 zone)

EMBL: CP001700.PE404

CP001700.PE404       Location/Qualifiers
FT   CDS_pept        453076..453852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69359"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK3"
FT                   /inference="similar to AA sequence:KEGG:Franean1_1635"
FT                   /protein_id="ACU69359.1"
FT                   /translation="MKALRKPERHAARQAWRMPGADLDRMFTLVRAVGQVELKFTVADA
FT                   SFDAVRGLLGVGVERVRNVYYLDTPDLTLRRHGVLARVRGGQRPNDSVVKLRPIDPGRV
FT                   PTAMLRCEDFTVEVDVTPDSFICSGALKQRLPGNAVERAVAARTPLRTLFSEDQIALLD
FT                   SRLSGRLTIDDLDPLGPVEVHRTRPRDGEPGRGLELQEWLYPDGSLLLEVSTRCTATDL
FT                   LQTAIQAKALLDEHGIQQAGPCPTKADTTLDYFTRQ"
     atgaaggcct tgcgcaaacc cgagcgccac gctgcccggc aggcctggcg gatgcccggc        60
     gccgacctgg accggatgtt caccctggtc cgcgccgtgg gacaggtgga actgaagttc       120
     acggtcgccg acgcgtcctt cgacgccgtc cgcggcctcc ttggcgtggg cgtcgagcgc       180
     gtccgcaacg tctactacct cgacaccccc gacctgaccc tgcgccgcca cggagtcctg       240
     gcccgagtcc gcggcggaca gcgccccaac gactcggtgg tcaaactgcg cccgatagac       300
     cccggccgcg tcccgaccgc catgctccgc tgcgaggact tcacggtcga ggtcgacgtg       360
     acccccgaca gcttcatctg ctccggcgcc ctcaaacaac gcctccccgg caacgccgtc       420
     gaacgcgccg tcgccgcccg cacccccctg cgcaccctgt tctccgagga ccagatcgcc       480
     ctcctcgaca gccgcctgtc cggccgcctc accatcgacg acctcgaccc cctcggcccg       540
     gtcgaagtcc accgcacccg cccccgcgac ggcgaaccag gccgcggcct ggaactccag       600
     gaatggctct accccgacgg ctcactactg ctcgaggtat cgacccgctg caccgccacc       660
     gacctcctcc aaaccgcgat tcaggccaag gccctcctgg acgagcacgg catccagcag       720
     gcgggcccat gcccgaccaa ggccgacacg acgctggact acttcacgcg ccagtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page