(data stored in ACNUC7421 zone)

EMBL: CP001700.PE405

CP001700.PE405       Location/Qualifiers
FT   CDS_pept        complement(454259..455722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0408"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_6391 drug/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69360"
FT                   /db_xref="GOA:C7PVK4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69360.1"
FT                   /translation="MPQTDSLARDAERVGSGAEARFDSDARSGSGSGSSSGSARSVGSP
FT                   KLTLFAALLGFVMIALDASAVNVALPAVGRGLGGSTAGLQWIVDAYTLMFAALLLSAGA
FT                   FSDRLGASRLYGGGAAAFTLASVACGLAPSLGFLIGARLVQGSAAALMLPSSLALVRQA
FT                   FPDASARAAAIAQWTMAGAASTAVGPVLGGALTSSVSWRSIFFLNLPVGLVILGALRRT
FT                   ERSVRRPAPLDLPGQLTAIVGLAALTYGVISGGASGFGRPQAWASVLLALVSFGAFGVV
FT                   EHRATEPMLPLGLLRDRVVAVCLAVGFVVNAAYYGLIFVFGLFAQDILGRSAVGAGLVF
FT                   MPTAILCTITNLFSARAAARWGARTPVLVGQLACAAGLLVLLLVNTHTSALELALLLLP
FT                   LAGGLGFAVPSLTAMMLSGIAPERAGLAGGVLNSFRQTGGALAVAGFGALVAQHGGFVT
FT                   GLHVSLLISVALLAVTTLGTLALPKVGRR"
     atgccgcaga cagattcgct cgctcgtgat gccgagcggg tcggttctgg ggctgaggct        60
     cgctttgact ctgacgctcg ctcgggatct ggctctggat ctagctctgg ctctgcgcgc       120
     tccgtcgggt cgccgaagct cacgctcttc gccgcgctgc tcggtttcgt gatgatcgcg       180
     ctggatgctt cggcggtgaa cgtcgcgctg ccggcggtcg gtcgcgggct cggcgggtcc       240
     acggcggggt tgcagtggat cgttgatgcc tacacgctga tgttcgccgc gctgctgctg       300
     tctgccggtg cgttctcgga ccggctcggc gcgagtcgct tgtatggggg tggagccgcc       360
     gcgttcacgc tggcttccgt ggcgtgcgga ttggcgccgt cgctcggctt cctgatcggg       420
     gcgcggttgg tgcagggcag tgcggcggcg ttgatgctgc cgtcgtcgtt ggcgttggtg       480
     cggcaggcgt ttccggacgc gtcggcacga gcggcggcga tcgcgcagtg gacgatggcc       540
     ggtgcggcgt ccacggcggt cggtccggtg ctcggcggtg cgctcaccag ctcggtgagc       600
     tggcggtcga tcttcttcct gaaccttccg gtgggcttgg tcatcctggg cgcgctgcgg       660
     cgtaccgagc gctcggtgcg gcgtccggca ccgctggacc tgccgggtca gctcactgcg       720
     atcgtcggtc tggcggccct gacttatggc gtgatctccg gaggcgcttc gggcttcgga       780
     cgtccgcagg cgtgggcgag cgtgctgctg gcgctggtgt cgttcggcgc gttcggcgtg       840
     gtcgagcacc gcgcgacgga gccgatgctg ccgctgggac tgctgcgcga ccgggtcgtg       900
     gcggtgtgcc tggcggtcgg cttcgtggtc aacgcggcgt actatggact gatcttcgtc       960
     ttcggcctgt tcgcccagga catcctggga cgctcggcag tcggcgccgg cctggtgttc      1020
     atgccgaccg ccatcctgtg cacgatcacg aacctgttct ccgcccgcgc cgccgcacgc      1080
     tggggcgcgc gcacaccggt gctcgtggga cagctcgcct gcgctgcggg actgctggtc      1140
     ctactgctgg tgaacaccca cacgagcgcc ctggagttgg cactgttgct gctgccactg      1200
     gccggcggac tcggcttcgc agtgccctca ctcaccgcga tgatgctcag cggcatcgca      1260
     ccggagcgag ccggcctggc gggaggagtg ctcaactcct tccggcagac cggcggcgca      1320
     ctcgcggtgg cagggttcgg tgcgctggtc gcgcagcacg gcgggttcgt gaccggacta      1380
     catgtcagcc tactgatctc ggtggcactg ctggcggtga cgacgctggg cacgctggcg      1440
     ctgccgaagg tggggcgacg gtga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page