(data stored in ACNUC7421 zone)

EMBL: CP001700.PE406

CP001700.PE406       Location/Qualifiers
FT   CDS_pept        455920..456831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0409"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: art:Arth_0445
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69361"
FT                   /db_xref="GOA:C7PVK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69361.1"
FT                   /translation="MTEQQPELGRFLRARRAGVAPADLGLPLGTGTRRTPGLRREELAA
FT                   LAGVSIDYYIRLERGKETRPSPAVVDALGRALRLDPEELAYLRELAAQAARGGAPTRQR
FT                   PAASRAVRPTLRRLLETVRPCPAYVLSRTNDVLAANPGGLFLTPGMVDWPEKKRNTIRY
FT                   TFLHPQARTLWPDWDIKARACVAHLRAVAGTDPDDPELAAIVGELAVKSPEFSHMWERY
FT                   DVRRVGNGQKTFLHPIVGTMTLCHEVMEINHTGGGRIVVYSAEPGTPDHDAMVLLDMEA
FT                   ATALASRSNASGAVSVDADRDG"
     atgaccgagc agcagcctga actcggcaga ttcctgcggg ccagacgggc cggcgtcgcc        60
     ccggccgacc tcggcctgcc gctgggcacg gggacccgcc gcacaccggg tctgcgccgc       120
     gaggaactcg ccgcgctcgc cggcgtcagc atcgactact acatccggct ggagcgcggg       180
     aaggagacgc ggccgagccc ggccgtcgtc gacgcgctcg gccgcgccct gcgcctggac       240
     cccgaagaac tcgcctacct gcgcgaactg gccgcccaag ccgcccgcgg cggcgcaccg       300
     acccggcagc gtcccgccgc ctcgcgcgcc gtgcgcccga ccctgcgccg gctgctcgag       360
     accgtgcgcc cctgcccggc gtacgtcctg agccgcacga acgacgtgct cgcggcgaac       420
     cccggcggcc tgttcctgac gcccggcatg gtggattggc cggagaagaa gcgcaacacg       480
     atccgctaca ccttcctgca cccgcaggcg cgcacgctgt ggccggactg ggatatcaag       540
     gcccgcgcat gcgtcgcgca cctgcgtgcc gtcgccggta ccgaccccga cgaccccgaa       600
     ctggctgcca tcgtcggcga actcgcggtc aagagcccgg agttcagcca catgtgggag       660
     cgctacgacg tgcgccgcgt cggcaacggc cagaagacct tcctgcaccc gatcgtcggc       720
     acgatgaccc tgtgccacga ggtgatggag atcaaccaca ccggcggcgg ccgcatcgtc       780
     gtctacagcg ccgagccggg caccccggac cacgacgcca tggtgctgct cgacatggag       840
     gccgccacgg cgctcgcctc ccggtcgaac gcctcgggcg ccgtcagcgt cgacgctgat       900
     cgggacggct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page