(data stored in ACNUC7421 zone)

EMBL: CP001700.PE407

CP001700.PE407       Location/Qualifiers
FT   CDS_pept        456966..458864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69362"
FT                   /db_xref="GOA:C7PVK6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69362.1"
FT                   /translation="MSAGTAVPDAAESVGELKPSRRSRRSAPDFASSLLRRDVFGVRLG
FT                   VLLLILPVILAGLGMQLTSRQGWNHPPDSRYYVAMMARDVGYSWSHSIHAELRVQPDNH
FT                   LSPWYFADNDPTWQMVRTRLLYPVLSVPFIWMWGLSGGSMAVPVLGTVLFLWATARLLQ
FT                   RLYGPAIAVIVAGGFSLTVPVNGFTWAGTDTLALGLAAVLVLNLPIERRIGKANLVWIG
FT                   AASIFIALTRQVGVLAPAMAGAGWLWLLVRERQWRNRWLGSLIVTAATTFLFQVLSMTL
FT                   APANTAGVIGHGETSYWGIFREFVHYLRIVTEEACTYMWHNDRMLYALFIAAGISVLAR
FT                   FKSDATAVFVGAVGATYVITAGVGFSGFMRYEMVMFPAAAVAAGQLVQLALGDHVRQPV
FT                   GAVAELEPAPTRTRTWFSDRFAALALTKPGRFLGLNLQRQDRWKPQLLFNSLVLAIVIG
FT                   VSLDGSWSSTVNAPASPSYAAAQGGSGYAVPPLAKPSADQTLRIMFAQAIGIAHGSAQL
FT                   QGALDWTHAMQYRPMAPDQPGWPNRAKDGTAVVNPNSMGMDIDMSEAYGRGLSLNSTVK
FT                   PDSVKILSRQVSEYGEDVVFTVEDTSGKVHQGTATTLYPIWHKNDPATVTALVFDA"
     atgagcgctg gcacagcggt ccccgacgcg gcggaatcgg tcggggagct caaacccagc        60
     cgcaggtcgc gccgctcggc tccggacttt gcctcctccc tcttgcgcag ggacgtcttc       120
     ggcgtgcgcc tcggcgtgct gctgctgatc ctgccggtca tcctggccgg gctcgggatg       180
     cagctgacca gccgccaggg ctggaaccat ccgccggaca gccgctatta cgtggcgatg       240
     atggcgcgcg acgtcggcta ctcgtggtcg cattcgatcc acgccgagct gcgggtccag       300
     ccggacaacc acctgtcgcc gtggtacttc gccgacaacg accccacctg gcagatggtg       360
     cgcaccaggc tgctgtatcc ggtgctgtcc gtgccgttca tctggatgtg gggtctgtcc       420
     ggcggctcga tggcggttcc ggtactcggc acggtcctgt tcttgtgggc gacggcccgg       480
     ctgttgcagc ggctctacgg tccggcgatc gcggtcatcg tcgcgggcgg cttcagtctc       540
     acagtcccgg tcaacggatt cacgtgggca ggtaccgaca ccctcgcgct ggggctggcc       600
     gcagtccttg tcctgaatct gccgatcgag cgccggatcg gcaaggcgaa cctggtctgg       660
     atcggcgcgg cgtcgatctt catcgcgttg acgcggcagg tcggggtgct cgctccggcg       720
     atggccggcg ccgggtggct gtggctgctg gtgcgcgaac gtcagtggcg caaccgctgg       780
     ttgggctcgc tgatcgtgac ggcggcgacc accttcctgt tccaggtcct gtcgatgacg       840
     ctcgcgccgg ccaacaccgc cggtgtcatc ggccacggtg agacctcgta ctggggtatc       900
     ttccgggagt tcgtccacta cctgaggatc gtcaccgaag aagcctgcac ctacatgtgg       960
     cacaacgacc ggatgctgta cgcgctgttc atcgcggcgg gcatctcggt cctggcgcgg      1020
     ttcaagtcgg atgcgaccgc cgttttcgtc ggcgcggtcg gcgccaccta cgtcattacc      1080
     gcaggcgtcg gcttctccgg cttcatgcgc tacgagatgg tcatgttccc cgccgccgca      1140
     gtcgctgccg gccaattggt ccagctggcg ctcggcgacc atgtgcggca accggtcgga      1200
     gcggtcgccg agctggaacc cgcgccgacc cggacgcgca cctggttctc cgaccgtttc      1260
     gctgccctgg cgctcaccaa gcccgggcgc tttctgggcc tgaacctgca acggcaggat      1320
     cgctggaagc cccagctgct cttcaactcc ctggtcctgg ccatcgtcat cggcgtttcg      1380
     ctcgacggct cctggtcctc gaccgtcaac gctcccgcct cgccgtctta cgccgcagcc      1440
     cagggcggct ccggctacgc ggtccctccg ctggccaagc cgtccgccga ccagacgctg      1500
     cgcatcatgt tcgcccaagc gatcgggatc gcccacggca gcgctcagct ccagggcgcg      1560
     ctcgactgga cgcacgcgat gcagtaccgc ccgatggcgc ccgaccagcc cggctggccc      1620
     aaccgcgcca aggacggcac cgccgtggtc aaccccaact ccatggggat ggacatcgac      1680
     atgtccgagg cgtacggccg aggcttgtcg ctgaactcga ccgtgaagcc ggacagcgtc      1740
     aagatcctga gtcgccaggt cagcgagtac ggcgaggacg tggtcttcac ggtcgaggac      1800
     acgtcaggca aggtccacca ggggacggcg accacgctgt acccgatctg gcacaagaac      1860
     gacccggcga cggtgaccgc gctggtcttc gatgcctga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page