(data stored in ACNUC7421 zone)

EMBL: CP001700.PE408

CP001700.PE408       Location/Qualifiers
FT   CDS_pept        complement(458870..459403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_4855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69363"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK7"
FT                   /inference="similar to AA sequence:KEGG:SACE_4855"
FT                   /protein_id="ACU69363.1"
FT                   /translation="MHELKALLREYDRARAYTDDLWTDLTPDEVTWRPHEESSAIGWHL
FT                   GHQAHVAHFMIRNLTAAEPSPDPELDELMDSANPEKFRGALPTVERLTTFRNTVAQRVH
FT                   ARIGAIADGQVGAPSQMTIVGSYLLVALINHEYQHDQWIGEVRAQNLGHALPADPTADG
FT                   LRRVDGYLVLEPLG"
     gtgcacgaac tcaaagccct gcttcgcgag tacgaccgcg cccgcgctta caccgacgac        60
     ctctggacgg acctcacgcc ggacgaggtg acctggcgcc cccacgagga atccagcgcc       120
     atcggctggc acctcggtca ccaggcgcac gtcgcgcact tcatgatccg caacctcacc       180
     gccgccgagc ccagcccgga cccggagttg gacgagctca tggactcggc gaacccggag       240
     aagttccgcg gcgcgctgcc cacagtcgaa cggctcacca cgttccgcaa caccgtcgcc       300
     cagcgcgtcc acgcacgcat cggcgccatc gccgatggcc aggtcggcgc gccgagccag       360
     atgacgatcg tgggcagcta cctgctggtc gcgctgatca accacgaata ccagcacgac       420
     cagtggatcg gcgaggtccg cgcccagaat ctggggcacg cactcccggc ggatcccacc       480
     gcggacgggc tccgccgcgt cgacggctac ctcgtcctcg agccgctcgg ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page