(data stored in ACNUC7421 zone)

EMBL: CP001700.PE409

CP001700.PE409       Location/Qualifiers
FT   CDS_pept        complement(459406..460905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0412"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_7490 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69364"
FT                   /db_xref="GOA:C7PVK8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69364.1"
FT                   /translation="MSHLQTTSLGPNAAHDPHDPHGEHAPQHARRWWILAVICLAQLMD
FT                   VLDVTIVNIALPDAQKSLDFSVGDRQWIVTAYSLAFGSLLLFSGRVSDLVGRRRMFLVG
FT                   LVAFAAASALGGAAPDFGVLVTARAVQGAAGAMLAPAALSLLSTTFTEPKERAKAFAVF
FT                   GGVSGSGAAIGMLLGGVLTEFLNWRFTLYVNVAIAVVAFIGAATLIQRRNETQSEIGER
FT                   PKLDLPGTILVSAALFGIVYGFADVESHAWTAPSTWVSLTSGVVLLGVFAWWQRQAANP
FT                   LLPLRIVLDRTRGGSILAIFLGSIGLFGAFLFLNFYLQGVLHYSPLMTGVAFLPMVVTL
FT                   VIAGGICTTQLYPRFGAKLPVTAGMLIAAAAMVLLTDIGPHSTYAGTVLGPLLVFGLGI
FT                   GATIAPAMSAGTADVEPRDAGIASATVNTAQQIGGSIGTALLNSLAASALGRYLVGKDA
FT                   ASHAVQTDAAIHSYSVAFWATGAIFAGGAVVCGLVLRRGKP"
     gtgtcccacc tgcaaacgac cagcctcggc ccgaacgccg cgcacgaccc gcacgacccg        60
     cacggcgagc acgcccctca gcacgcccgc cgctggtgga tcctcgcggt aatctgcctg       120
     gcccagctca tggacgtcct ggacgtcacc atcgtcaaca tcgccctgcc cgacgcccag       180
     aagagcctcg acttctcggt cggcgaccgg cagtggatcg tcaccgccta ctccctcgcc       240
     ttcggcagcc tgctgctgtt ctccggccgc gtctccgacc tcgtcggacg gcgccggatg       300
     ttcctggtcg ggctcgtcgc cttcgccgca gcctccgcgc tcggcggtgc ggcaccggac       360
     ttcggcgtcc tcgtcaccgc gcgcgccgtc caaggcgccg ccggcgcgat gctcgctccc       420
     gccgcgctct ccctgctgag caccacgttc accgagccca aggagcgcgc caaggcgttc       480
     gccgtgttcg gcggcgtctc cggctccggc gccgcgatcg gcatgctgct cggcggcgtg       540
     ctgaccgagt tcctgaactg gcgcttcacg ctgtacgtga acgtcgccat cgccgtcgta       600
     gcgttcatcg gcgccgccac gctgatccag cgccggaacg aaactcaatc cgagatcggc       660
     gagcgcccga agctcgacct ccccggcacg atcctcgtct ccgccgcact gttcggcatc       720
     gtctatggct tcgccgacgt cgagtcgcac gcgtggaccg cgccgagcac ctgggtgtcc       780
     ctgacctccg gcgtcgtcct actcggcgtc ttcgcctggt ggcaaagaca ggccgcgaat       840
     cccttgctgc cactgcggat cgtcctcgac cgcacccgcg gcggctcgat cctcgcgatc       900
     ttcctgggca gcatcggcct gttcggcgcc ttcctgttcc tcaacttcta cctccaaggc       960
     gtgctgcact actcgccgct catgaccggc gtcgcgttcc tgccgatggt cgtcacgctc      1020
     gtgatcgccg gaggcatatg caccacgcag ctctacccga ggttcggcgc gaagctcccg      1080
     gtgaccgccg gcatgctcat cgccgccgct gccatggtct tgctcaccga catcggtccg      1140
     cacagcacgt acgcgggcac cgtcctcggt ccgctcctgg tgttcgggct cggcatcggc      1200
     gccacgatcg ccccggcgat gagcgccggt accgccgacg tcgaaccgcg tgacgcgggc      1260
     atcgcctcgg cgaccgtcaa caccgctcag cagatcggcg gctcgatcgg caccgcgctg      1320
     ttgaactccc tcgccgcctc agcgctgggc agatatctgg tcggcaagga cgccgccagc      1380
     catgccgtgc agaccgacgc cgcgatccac agctatagcg tcgcgttctg ggcgaccggc      1440
     gcgatcttcg ccggcggcgc ggtcgtctgt ggactcgtgc tgcgacgtgg taagccataa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page