(data stored in ACNUC7421 zone)

EMBL: CP001700.PE41

CP001700.PE41        Location/Qualifiers
FT   CDS_pept        complement(43506..44222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0041"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: kra:Krad_0027 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68996"
FT                   /db_xref="GOA:C7QFQ7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ7"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU68996.1"
FT                   /translation="MWAESARTAIRSVGEILITLGLVLFLFCAYQLFYTNVVADEAMKS
FT                   EVSDLHKLWDAPVARAAAPRAANAFDTADSHGTAGAAFAILHIPRLGDKSIPVLQGTTL
FT                   DLLGRGVGHYKDSAMPGRTGNFAVAGHRKTHGEPFRYLDEMRDGDLIVVETADSWYTYR
FT                   EDRDPFIVDPTDLGVVAPVPDHPGATPSRKLITLTTCNPWWASTQRMIVTGELIAQQPR
FT                   SAGEPPAMTVNAPKFQ"
     atgtgggctg aaagcgcgcg aacagcgatc cgatccgtcg gggagatcct gatcacgctc        60
     ggcctggtgc tcttcctgtt ctgcgcctac cagctcttct acaccaacgt ggtcgccgac       120
     gaggcgatga agtccgaggt ctccgaccta cacaagctgt gggacgcgcc ggtcgcccgg       180
     gccgccgccc cgcgggctgc caacgcgttc gacaccgccg acagccacgg cacggccggc       240
     gcggcgttcg cgatcctgca catcccgcgc ttgggcgaca agtcgatccc ggtcctacag       300
     ggcaccacgc tcgacctctt gggacgcgga gtcggccact acaaggactc cgcgatgccc       360
     ggccgcaccg gcaacttcgc cgtcgccggg caccgcaaga cgcacggaga gccgttccgc       420
     tacctcgacg agatgcgcga cggcgacctc atcgtcgtgg agaccgccga cagctggtac       480
     acctaccgcg aagaccgcga cccgttcatc gtcgacccga ccgacctcgg cgtcgtcgcc       540
     ccggtcccgg accaccccgg cgcgacgccc tcgcgcaagc tcatcacgct gacgacctgc       600
     aacccgtggt gggcctccac ccagcgcatg atcgtcaccg gcgagctgat cgcccagcag       660
     ccacgctcgg ccggcgagcc gccggcgatg accgtgaacg cccccaagtt ccaatag          717
//

If you have problems or comments...

PBIL Back to PBIL home page