(data stored in ACNUC7421 zone)

EMBL: CP001700.PE410

CP001700.PE410       Location/Qualifiers
FT   CDS_pept        complement(460925..461656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0413"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: amr:AM1_3890 oxidoreductase, short
FT                   chain dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69365"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69365.1"
FT                   /translation="MTVKTALITGTSRAAGLGFAVARELAEQGFHVILTARDRAAAEPL
FT                   AEQLRLDGHAATALRLDLSDRASMDAVAKHVAETFGHLDVLVNNASGMPDFQVLSALEA
FT                   DMDTVRAALEVSVIGPWGLVEAVLPLLKAAPAARVVNVSSLSAQQIATGLNLGAPLRSP
FT                   AYSMAKYMLNALTSVLARALADTPILVNAVDPGNTATHPERGDDDSDRPAAESARDIVR
FT                   AATFGSDGPSGVLFSGGQPVA"
     gtgaccgtga agaccgccct catcaccggg accagccgcg ccgccggact cggcttcgcc        60
     gtggcgcgtg agctggccga acagggcttc cacgtgatcc tcaccgcccg cgaccgcgcc       120
     gccgccgaac ccctcgccga gcagctgcgc ctggacggcc acgccgccac cgcgctgcgc       180
     ctggacctgt ccgaccgcgc cagcatggac gccgtcgcga agcacgtcgc cgagaccttc       240
     ggccaccttg acgtgctggt caacaacgcc agcggcatgc ctgacttcca ggtcttgtcg       300
     gctctcgagg ctgacatgga cacggtccgc gccgcgctgg aggtgtcggt gatcggtccg       360
     tgggggctgg tcgaggcggt gctgccgctg ctgaaggccg ctccggcagc gcgggtcgtg       420
     aacgtctcga gcttgtcggc gcagcagatc gcgacgggcc tgaacctcgg cgcgccgctg       480
     cgctcccccg cctactcgat ggcgaagtac atgctcaatg ccctgacctc ggtgctcgcc       540
     cgcgccctcg cggacacgcc gatcctcgtc aacgccgtcg accccggcaa caccgccacg       600
     caccccgagc gcggcgacga cgactccgac cgccccgccg ccgagagcgc gcgcgacatc       660
     gtgcgtgccg cgaccttcgg ctccgacggt cccagcggag tccttttcag cggcgggcaa       720
     cccgtcgcct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page