(data stored in ACNUC7421 zone)

EMBL: CP001700.PE411

CP001700.PE411       Location/Qualifiers
FT   CDS_pept        461750..462451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0414"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Tetracyclin repressor domain protein;
FT                   regulatory protein TetR; KEGG: sma:SAV_775 TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69366"
FT                   /db_xref="GOA:C7PVL0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL0"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ACU69366.1"
FT                   /translation="MAAEPAEPAEPAEPAPRKTPITLERITDAALQVVATEGYDALTIR
FT                   RVTNVLGTGPSSLYAHIATKTDIDDLLIGRLCSEITLPDPDPATWQHQLRDVYAQLRDQ
FT                   YLKYPGISKAALATVSANPETLRVSEGIFAILLSAGIDPQTAAWTMDAITLYVAAYALE
FT                   LSLVHHRRKDPTTPWLLSHEALTAHLTSLPEATFPQTRRHAAALTSGTGHQRFDFALTL
FT                   LIDNLTSQTKS"
     atggccgccg aacccgccga acctgccgaa cccgccgaac ccgccccgcg caaaaccccc        60
     atcaccctcg agcgcatcac cgacgccgca ctccaggtcg tggcgaccga gggctacgac       120
     gcgctgacca tccgccgcgt cacgaacgtc ctgggcaccg gaccctcatc cctgtacgcc       180
     cacatcgcca ccaagacaga catcgacgac ctcctcatcg gccgcctctg ctccgagatc       240
     accctccccg accccgaccc cgccacctgg cagcaccaac tccgcgacgt ctacgcccaa       300
     ctccgcgacc agtacctgaa gtaccccggc atctccaaag ccgccctggc caccgtctcc       360
     gccaaccccg aaaccctccg cgtcagcgaa ggcatcttcg ccatcctcct gtccgccggc       420
     atcgaccccc agaccgccgc ctggaccatg gacgccatca ccctctacgt agccgcctac       480
     gccctcgaac tctccctggt ccaccaccgc cgaaaagacc ccaccacccc ctggctcctc       540
     agccacgaag ccctcaccgc ccacctcacc tcccttcccg aagccacctt cccccagacc       600
     cgccgccacg ccgccgccct gacctccggc accggccacc agcgcttcga cttcgccctc       660
     acgctgctga tcgataactt gacgagtcag acgaagtcgt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page