(data stored in ACNUC7421 zone)

EMBL: CP001700.PE412

CP001700.PE412       Location/Qualifiers
FT   CDS_pept        462581..464764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0415"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; helicase domain protein; KEGG:
FT                   sgr:SGR_1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69367"
FT                   /db_xref="GOA:C7PVL1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL1"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACU69367.1"
FT                   /translation="MPRGQAFTNSSGVKSVLHAAADAETAIREMHEGDERRHQAVRDAY
FT                   QASHAVAVLGRLRSISIERLRDVTGARLPVTKLEEAGYKSIADLLEATPEQLQQVPGIG
FT                   TKGAERTVDAARRIADAAMSGTHVTADMDLRVADAATLLAALYRVQTADRVLLKVREPA
FT                   KRIGGALTSLADTAKPLSSRMRRVITGRAKREEAQGAVDRLEGLLGDPATNQDLERIKA
FT                   ANEKLRGVKPPRPSVVRNDFEKRSADYFSTLSRIAGARANGEAARGFLPTSLADRIGVQ
FT                   QLDETHLRVSLRAYQAFGVRFALAQKRVVIGDEMGCGKTVEAIATLAHLRAEGAKHFLV
FT                   VVPASVLINWLREVRAHSSLRPYRLHGPQGEAALKAWLSGGGVGITTFEALPNLELPPR
FT                   TRISMLVVDEAHYVKNPNTMRSRAVRAWTDRVERVMFLTGTPMENRVEEFRNLVGYLQP
FT                   DLVDSVGEIDAVAGSEAFRKAVAPAYLRRNQEDVLSELPEMVKIEEWEEFGPEEEAMYR
FT                   DAVAARNFMAMRRAAYATGDPATSAKLRRLVEIVDEAEANSRKVVVFSYFRDVLDTVCR
FT                   ALGDRASGPLTGSMQPQHRQELVDAFTAAKKHAVLVSQIQAGGVGLNMQAASVVILCEP
FT                   QVKPTLETQAIARAHRMGQIRRVQVHRLLVADSVDQRMLEILDAKSGLFDAYARRSETA
FT                   ETMPEAKDLSDASVRKQLIDAEQERLGLDKARS"
     atgcctagag gacaggcgtt caccaactcg tctggtgtga agtctgtgct gcatgctgct        60
     gcggatgctg agacggcgat ccgtgagatg catgaggggg acgagcggcg gcatcaggct       120
     gtgcgggatg cctatcaggc ctcgcacgct gttgccgttc ttgggcggtt gcggtctatt       180
     tccattgagc ggctcagaga tgtgaccggg gctcggcttc cggtcacgaa gctggaagag       240
     gccgggtaca agtccatcgc tgatctgctt gaggcgacgc cggagcagtt gcagcaggtg       300
     ccggggatcg ggaccaaggg tgctgagcgc accgtggatg cggcgcggcg gattgctgat       360
     gccgccatgt ccggtacgca tgtcaccgct gacatggatc tgcgggtcgc ggatgccgct       420
     acgctgctcg ccgccttgta ccgcgtgcag accgcggacc gggtgctgct gaaggttcgt       480
     gagccggcga agcggatcgg tggggcgctg acgagtttgg ccgacaccgc caagccgctc       540
     agcagtcgga tgcggcgggt gatcaccggg cgtgccaagc gcgaggaggc gcagggcgcg       600
     gtcgatcggc tggaggggct gctcggcgat cccgcgacga accaggatct ggagcgcatc       660
     aaggcggcga acgagaagct gcggggggtc aagccgccgc ggccgagtgt cgtccgcaac       720
     gacttcgaga agcgttccgc cgactacttc agcaccctga gccgcatcgc gggtgcccgg       780
     gcgaacggcg aggcggcgcg cggctttctg cccacgagcc ttgccgaccg gatcggggtg       840
     cagcagctcg acgagacgca tctgcgcgtc tccttacgcg cctaccaagc gttcggcgtc       900
     cgcttcgcgc tcgctcagaa gcgcgtcgtc atcggcgacg agatgggctg tggcaagacc       960
     gtcgaggcga tagcgacgct cgcgcacctg cgcgccgagg gcgcgaagca cttcctcgtc      1020
     gtcgtccctg ccagtgtgct gatcaactgg ctccgcgagg tgcgtgcgca cagctccctg      1080
     cgtccctatc ggctgcacgg cccgcagggg gaagccgccc tgaaggcgtg gctgtccggc      1140
     ggcggcgtcg gcatcaccac cttcgaagcc ctcccgaacc tggagctgcc gccccggacg      1200
     cgcatctcga tgctcgtcgt cgacgaggcg cactatgtga agaaccccaa cacgatgcgc      1260
     tccagagccg tgcgtgcctg gaccgaccgg gtcgagcgcg tcatgttcct gaccggcacg      1320
     ccgatggaga accgcgtcga ggagttccgc aacctggtcg gctatctcca gccggatctc      1380
     gtcgactcgg tcggggagat cgacgcggtc gccggctccg aagccttccg caaagccgtg      1440
     gcgcccgcct atctccggcg aaaccaggaa gacgtgctct ccgagctccc cgaaatggtg      1500
     aagatcgagg agtgggaaga gttcggaccc gaggaagagg ccatgtatcg cgatgcggtc      1560
     gcggcgcgga acttcatggc gatgcggcgt gcggcgtacg ccacgggcga cccggccacg      1620
     tcggcgaaac tgcgccgctt ggtcgagatc gtcgacgaag ccgaggccaa cagccggaaa      1680
     gtggtcgtct tctcctactt ccgcgacgtc ctggacaccg tgtgccgagc cctcggcgac      1740
     cgtgccagcg ggccgctcac cggctccatg cagccgcagc accgccagga actcgtcgat      1800
     gccttcaccg ccgcgaagaa gcacgccgtt ctggtcagcc agatccaggc cggcggcgtg      1860
     ggcctgaaca tgcaggcggc ctcggtggtc atcctgtgcg agccgcaggt caagcccacc      1920
     ctggagaccc aggcgatcgc cagggcgcac cgcatgggcc agatccgccg cgtccaggtg      1980
     caccggctgc tggtcgccga cagcgtcgac cagcggatgc tggagatcct ggacgccaag      2040
     tcaggactct tcgacgccta cgctcgccgc agcgagaccg ccgaaacgat gccggaggcg      2100
     aaggatctgt ccgacgcctc ggtgcgcaag cagctcatcg acgccgagca ggaacggctc      2160
     gggttggaca aggcgcgctc gtga                                             2184
//

If you have problems or comments...

PBIL Back to PBIL home page