(data stored in ACNUC7421 zone)

EMBL: CP001700.PE413

CP001700.PE413       Location/Qualifiers
FT   CDS_pept        464809..465810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69368"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL2"
FT                   /inference="similar to AA sequence:KEGG:SACE_2039"
FT                   /protein_id="ACU69368.1"
FT                   /translation="MEPARLGQLRRDLAHAVRMGPFSATLHLAIEASGMTLEQVRLELA
FT                   ARGAFVSMATLSYWRRGMSRPERPESLHAVELLEEVLALSTGALTGQLGPRRPRGRTAA
FT                   RRESGLDVVDAWDAHREYDHLLQGLDPAGRLELTRVSTLDRYSLGADRRELSLTTCQVL
FT                   RAEADDLSRMTVLYRTYDPPSPSPVLKALNGCRVGRVRIAQDSGFVAAELLFDRVLRRG
FT                   ETAVVDYELTGLSPSPPTETDFYQRFFPYATALYVLRVQFDPATVPARCVRYERRTETA
FT                   PDQGVREVWVGATGQAHVMATDVPPGVVGLRWDWGAGLHDLPSLGRGDPPAR"
     atggagcccg cccggttggg acagctgcgt cgcgacctgg ctcatgccgt ccgcatgggc        60
     ccgttctccg cgacgctgca tctggcgatc gaggccagtg gcatgacgct ggaacaggtc       120
     cgcctggagc tggccgcccg cggcgccttc gtgtcgatgg cgacgctgag ctactggcgc       180
     cggggcatga gccgtccgga gcggccggaa tcgctgcacg cggtggagtt gctggaggaa       240
     gtcctcgcgc tgtcgaccgg agcgttgacc gggcagttgg gcccgcgccg accgcgcgga       300
     cgcaccgccg cacgcaggga atccgggttg gacgtggtcg acgcctggga cgcgcaccgc       360
     gaatacgacc acttactcca gggccttgat cccgcgggac gcctggagct cacacgcgta       420
     tccaccctcg atcggtacag cctcggcgcg gaccgtcgcg agctgtcgct gacgacctgc       480
     caggtcctgc gtgccgaggc cgacgacctg agccgcatga cggtgctgta ccgcacctac       540
     gatccgccgt caccctcgcc ggtcctgaaa gcgctgaacg gctgccgcgt cgggcgcgtg       600
     cgcatcgcgc aggacagcgg tttcgtagca gcagagctgc ttttcgaccg cgtcctgcgc       660
     cgcggggaga ccgctgtcgt ggactacgag ctgaccggtc tgtcgccgtc cccgccgacc       720
     gagaccgact tctatcagcg cttcttcccc tacgcgacgg cgctgtacgt cctgcgggtc       780
     cagttcgatc ccgcgaccgt cccggcgcgc tgcgtgcgct acgaacggcg cacggaaacc       840
     gcgccggacc aaggggttcg cgaggtgtgg gtgggagcga ccgggcaggc gcacgtgatg       900
     gcgacggacg tcccgcccgg tgtcgtcggg ctgcgctggg attggggagc gggcctccac       960
     gacctgcctt cgctcggccg tggagacccg cccgctcggt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page