(data stored in ACNUC7421 zone)

EMBL: CP001700.PE414

CP001700.PE414       Location/Qualifiers
FT   CDS_pept        complement(465862..467640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0417"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; KEGG: bam:Bamb_0804
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69369"
FT                   /db_xref="GOA:C7PVL3"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL3"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACU69369.1"
FT                   /translation="MRRILLAGVITSALSTVAAMAMVQPAEAAVSPQIVPASCASAPAG
FT                   HAHCNAVQLVPSGARPAAPTGFGPSDIQSAYNLGTNPGSGQTVAIVDAYDDPNAESDLR
FT                   TYRSQWGLSACTTANGCFSKVDQNGGTTYPSGDSGWGAEITLDLDAVSAACPGCHILLV
FT                   EATTNDDNDLGAAVDEAVRLGAKFVSNSYSDAESDFTTGMDAHYNHPGVMIAAATGDNG
FT                   TQSGSSAQFPATFPSVVAVGGTSLSQASNSRGWSESVWNKGGSGCSSLFAKPSYQQNVT
FT                   TNCAKRASADVSADANPNTGLAIYDSYGQSGWEEYGGTSLATPLISAMWAQAGAPASGD
FT                   SGVSYLYANEAKFNDVTSGSNGSCGTVICNAGTGWDGPTGVGTPNGVSGFASGTTPPPP
FT                   ANDFSVSVSPASGSVNPGSSATSTVGTKVASGSAVTVQLSASGLPSGASASFNPASVTA
FT                   GSSSTMTIATSASTPAGTYSVTVTGTAGSTTHTAAYSLTVNGTGGGGTVTVSNPGTQLW
FT                   FVGYQSQPLQIRASDSKNLALTFSATGLPPGLGISASGVISGTPTRAGTYQVTVKATDS
FT                   GGGSGSTTFGYQVYGF"
     atgaggcgga tactcctggc cggcgtgatc acgtcggcct tgtccaccgt cgccgcgatg        60
     gcgatggtgc agcctgccga agcggcggtg agtccccaga tcgtccccgc gagctgtgcc       120
     agcgccccag ccgggcacgc acactgcaac gcggtccagc tggtgcccag cggggcacgt       180
     ccggcggctc ccacgggctt tggacccagc gacatccagt ccgcctacaa cctgggtacc       240
     aaccccggca gcggccagac ggtcgccatc gtggacgcct acgacgaccc caacgccgag       300
     agcgacctgc ggacctaccg ctcgcagtgg ggactgtcgg cgtgcacgac ggcgaacggc       360
     tgcttctcga aggtggacca gaacggcggc accacctacc ccagcggcga ctccggatgg       420
     ggcgcggaga tcacgctgga cctggacgcg gtgagcgcgg cgtgtcccgg ctgccacatc       480
     ctgctggtcg aggcgaccac caacgacgac aacgatttgg gcgcggctgt cgacgaagcg       540
     gtgcggctcg gcgcgaagtt cgtgtccaac agctactccg acgccgagag cgacttcacc       600
     accggcatgg acgcgcacta caaccacccc ggcgtgatga tcgcggcggc gaccggcgac       660
     aacggcacgc agtccggctc cagcgcgcag ttcccggcca ccttcccgag cgtggtggcg       720
     gtcggcggca cgtcgctgag tcaggcctcg aactcgcgcg gctggtccga atcggtgtgg       780
     aacaagggcg gttcgggctg ctcctcgctg ttcgccaaac cctcctacca gcagaacgtc       840
     acgaccaact gcgccaagcg ggccagcgcc gacgtctcgg ccgacgccaa cccgaacacg       900
     ggcctggcga tctatgacag ctacggccag tccggatggg aggagtacgg cggcacctcg       960
     ctggcgactc cgctgatctc ggcgatgtgg gcccaagccg gcgccccggc gtccggcgac      1020
     agcggcgtgt cctacctgta cgccaacgag gcgaagttca acgacgtcac cagcggcagc      1080
     aacggctcct gcggcacggt gatctgcaac gccgggaccg gctgggacgg cccgaccggc      1140
     gtcggcacgc cgaacggcgt ctccggcttc gcctcgggca ccactccgcc gccgccggcc      1200
     aacgacttct cggtgtcggt gagcccggct tccggttcgg tgaaccccgg ctcgtcggcg      1260
     acgagcacgg tcggaaccaa ggtcgcctcc ggctcggcgg tgacggtgca gctgtccgcc      1320
     tcgggtctgc cctccggcgc ctccgcgagc ttcaaccccg cctcggtcac cgcgggcagc      1380
     agctcgacga tgaccatcgc cacctcggcg tccacgccgg ccgggacgta ctcggtgacg      1440
     gtcaccggga ccgccggcag caccacgcac accgcggcgt actcgctcac cgtcaacggg      1500
     accggcgggg gcggaaccgt caccgtgtcg aacccgggca cccagctgtg gttcgtcggc      1560
     taccagtccc agccgctgca gatccgggcc tcggacagca agaacctggc gctgacgttc      1620
     agcgccacgg gtctgcctcc gggtctgggg atcagcgcct ccggcgtcat ctccggaacc      1680
     cccacgaggg cgggcaccta ccaggtgacc gtcaaggcca cggactcggg cggcggctcg      1740
     ggctccacga cgtttggata ccaggtgtac ggcttctga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page