(data stored in ACNUC7421 zone)

EMBL: CP001700.PE415

CP001700.PE415       Location/Qualifiers
FT   CDS_pept        468043..469284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0418"
FT                   /product="protease-like protein"
FT                   /note="KEGG: bmv:BMASAVP1_A0748 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69370"
FT                   /db_xref="GOA:C7PVL4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL4"
FT                   /inference="protein motif:COG:COG4934"
FT                   /protein_id="ACU69370.1"
FT                   /translation="MRTNLRPAHRRAAISLAAAAVLGITAAAVATSANAAGAPAAKSAG
FT                   PAWSRACDAPAPGMAACDALHVTNVPEHIRALGVTPNATPSGFGPADLRSAYKLPANGG
FT                   AGQTVAIVDAYNDPNAAADMATYRSQFGLPACTVASGCFKQVSQTGTSTLPANNTGWAG
FT                   EISLDLDMVSAVAPNAHIILVEAKTASMANLGTAVNEAVKLGAKFVSNSYGGGESSADT
FT                   GYDTKYFQHSGVAITASSGDGGYGVEYPAASPYVTAVGGTALKKDSSARGWSESVWSTN
FT                   STEGAGSGCSAYEPKPTWQKDTGCSKRTVADVSAVADPATGVAVYQTYGGSGWAVYGGT
FT                   SVASPLIAAVYADAGTPKASVPAANIYSHTSALNDVTTGKTATCTPKYLCTAGTGFDGP
FT                   TGWGTPNGLAAFTG"
     ttgcgtacca acctgcgccc ggcccaccgt cgtgccgcga tatccctggc cgcggcagcg        60
     gttctgggta tcaccgccgc agccgtggcc acctccgcca acgccgccgg agcccccgcc       120
     gccaagtccg ccggacccgc gtggtcccgg gcctgcgacg cccccgcgcc cggcatggcc       180
     gcttgcgacg cgctgcacgt caccaacgtt ccggagcaca tccgggcact cggcgtgacc       240
     ccgaacgcca ccccctccgg cttcggtccc gccgacctgc gctcggccta caagctgccc       300
     gccaacggcg gcgccggcca gaccgtcgcg atcgtggacg cctacaacga cccgaacgcc       360
     gccgcggaca tggccaccta ccgcagccag ttcggcctgc cggcgtgcac cgtggcctcc       420
     ggctgcttca agcaggtcag ccagaccggc accagcaccc tgccggcgaa caacaccggc       480
     tgggccgggg agatctcgct ggacctggac atggtctcgg cggtcgcgcc caacgcgcac       540
     atcatcctgg tcgaggccaa gaccgcctcg atggccaacc tcggcaccgc ggtcaacgag       600
     gcggtgaaac tcggcgcgaa gttcgtctcc aacagctacg gcggcggcga gtccagcgcc       660
     gacaccggct atgacaccaa gtacttccag cactccggcg tcgccatcac cgcctcctcc       720
     ggcgacggcg gctacggcgt ggagtacccg gcggcctcgc cctacgtcac cgccgtcggc       780
     ggcaccgcgc tgaagaagga cagctcggcg cgcggctgga gcgagtcggt gtggtccacc       840
     aactccaccg agggcgccgg ctccggctgc tcggcgtacg agccgaagcc cacctggcag       900
     aaggacaccg gctgcagcaa gcgcaccgtc gcggacgtct ccgcggtcgc cgacccggcc       960
     accggcgtcg cggtctacca gacctacggt ggcagcggct gggcagtcta cggcggcacc      1020
     tccgtcgcct ccccgctgat cgccgccgtc tacgccgacg ccggcacccc gaaggcgtcc      1080
     gtcccggccg cgaacatcta cagccacacc tccgcgctga acgacgtcac caccggcaag      1140
     acggcgacct gcacgccgaa gtacctgtgc accgccggca ccggcttcga cggcccgacc      1200
     ggctggggca cgccgaacgg cctggccgcc ttcaccggct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page