(data stored in ACNUC7421 zone)

EMBL: CP001700.PE416

CP001700.PE416       Location/Qualifiers
FT   CDS_pept        469477..470052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0419"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_1454 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69371"
FT                   /db_xref="GOA:C7PVL5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL5"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69371.1"
FT                   /translation="MPEFTEFAQARQAHMRRMAFLLCGNWHDAQDVTQIALMNLCRAWS
FT                   RARRADSIDAYAHRVVVRAYLSQRKKVLRQQARAVEYARASERVPGSAEESGEPELRMA
FT                   LLAALAQLPPRGRAVVVLRFWEDLSIEATAEALGCSTGNVKSQASRSLAKLREILGDSL
FT                   FDEGDGGGPRRAHVHAGVRPVWEVDGRA"
     gtgccggagt tcaccgagtt cgcgcaggcg cgccaagcgc acatgcggcg gatggcgttc        60
     ctgttgtgcg ggaactggca tgacgcgcag gacgtcaccc agatcgcgct gatgaacctg       120
     tgccgggcgt ggagccgggc gcggcgggcg gactccatcg acgcctacgc gcatcgcgtc       180
     gtcgtccgcg cctatcttag tcagcgcaag aaggtgctgc ggcagcaggc acgcgctgtg       240
     gagtacgcgc gcgcctccga gcgtgtgccg ggttcggctg aggagtcggg ggagcccgag       300
     ctgcggatgg cgctgctcgc cgcgctggcc cagcttccgc cgcgcgggcg ggcggtcgtg       360
     gttctccggt tctgggagga cctgagcatc gaggcgaccg ctgaggcgct cgggtgctcg       420
     accgggaatg tgaagagcca ggcctcgcgg tcgttggcca agctgcggga gatcctcggc       480
     gactcgctgt tcgacgaggg cgacgggggc gggcctcgtc gcgcgcatgt gcacgccggg       540
     gtgcgtccgg tgtgggaagt ggatggccga gcatga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page