(data stored in ACNUC7421 zone)

EMBL: CP001700.PE417

CP001700.PE417       Location/Qualifiers
FT   CDS_pept        470049..471098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69372"
FT                   /db_xref="GOA:C7PVL6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69372.1"
FT                   /translation="MTENPGRLRALLDDTLTDEPPLLDLVPDAVTAAEQGRRRGRMMAG
FT                   GAAVAVLAVSVGAYAVADHGRSGTNGSPIVSPGISRSSTSAAPPVRLSHKSTLGIPGLF
FT                   DHPGTPQQECAKVNGPVMDSKAQLSSPAERNYCIQSLQTIRALLPDAVVVLNPFVDFNQ
FT                   PAWSAPLVQTPDGGTAPGFTQAYQQSAKNSAKTVYLAGTFAFRTANGEGSIIYTTTSPG
FT                   VKAKPQGGDLPLDDGTSGRIAHEDSGSIDVTGVTADGVWYRLEISGVGPVYGADGSTLE
FT                   PNLHTDGQGHSVFPDGYVAAGDSALHMHIPNPYTVTEVRQKIVDMGLGNVIHTMGVDPL
FT                   SDYPAPPAG"
     atgactgaga accccgggcg tcttcgagcc ctgctggacg acaccctgac cgacgagccg        60
     ccgttgctcg acctggtccc cgacgccgtc accgcagccg aacagggccg gcggcgcgga       120
     cggatgatgg ccggcggcgc cgcggtggcg gtgttggcgg tgagcgtcgg cgcctacgca       180
     gtggccgatc acggccgcag cggtaccaac ggatccccta tcgtgtcgcc gggcatcagt       240
     cggagctcga cgtcggccgc cccgcctgtg cggttgtcgc acaagagcac cctcggcatc       300
     cccggtctgt tcgaccaccc cggcacgccg caacaggagt gcgcgaaggt gaacggaccg       360
     gtcatggact ccaaggcgca gctgtcctcg ccggcggagc ggaactactg catccaatcc       420
     ctgcaaacga tccgcgctct gctgcccgac gccgtcgtgg tcttgaaccc cttcgtcgac       480
     ttcaaccagc cggcctggag cgcaccgctg gtccagacac ccgacggcgg cacggctccc       540
     ggcttcacgc aggcgtatca gcagagcgcc aagaactcgg cgaagacggt ctacctcgct       600
     gggaccttcg ccttccgcac tgcgaacggc gagggctcga tcatctacac caccacatca       660
     ccgggggtga aggccaagcc gcagggcggt gacctgccgc tggacgacgg gacttctggg       720
     cgtatcgcgc acgaggactc cggcagcatc gacgtgaccg gggtgaccgc cgacggcgtc       780
     tggtaccgct tggagatcag cggcgtcggt ccggtgtacg gtgcggacgg ttcgacgctc       840
     gagcccaacc tccacaccga cggccaaggc cattcggtct tcccggacgg ctacgtcgct       900
     gccggcgatt ccgcgttgca catgcacatc ccgaacccct acaccgtgac cgaagtccgt       960
     cagaagatcg tggacatggg cctggggaac gtgatccaca ccatgggtgt ggacccgctg      1020
     tccgactatc ccgcgccgcc cgccggctag                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page