(data stored in ACNUC7421 zone)

EMBL: CP001700.PE418

CP001700.PE418       Location/Qualifiers
FT   CDS_pept        complement(471179..471757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0421"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   sco:SCO1356 iron sulphur protein (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69373"
FT                   /db_xref="GOA:C7PVL7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL7"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACU69373.1"
FT                   /translation="MTTVDLAAATQTTDKHACLGHPEGTSRRTALLGIAVAAGAVCAGC
FT                   SSSKSSSASTSPSTSAAAGSTSAADSSSSSSAAGSSTGTASSSASSSGSSGAAGALAAT
FT                   SAVPVGGGTVLTDQKIVLTQPTAGTFKAFTAVCTHQGCVVGSVANGLIVCPCHGSAYHI
FT                   ADGSVANGPAPTALAEIAIKVSGGEITQA"
     atgaccaccg ttgacctcgc cgccgccacc cagaccacgg acaagcacgc ctgcctcggg        60
     caccctgagg gcaccagccg ccggacggcc ctgctcggca tcgcggtggc ggccggcgcc       120
     gtgtgcgcgg gctgctcgtc ctcgaaaagc agcagcgcct cgacgagccc ttcgacgtcc       180
     gccgccgccg ggagcacctc ggcggccgac agcagcagtt cctcctccgc cgcgggttcc       240
     agcaccggga ccgcttcgtc ctccgcttcg tcctccgggt cctccggcgc ggccggggcc       300
     ctcgcagcca cctcggccgt cccggtcggc ggcggcaccg tcctcaccga ccagaagatc       360
     gtcctgaccc agccgaccgc cggcaccttc aaggccttca ccgcggtctg cacccaccag       420
     gggtgcgtgg tcggctcggt cgccaacggc ctgatcgtct gcccctgcca cggcagcgcg       480
     taccacatcg ccgacggctc ggtggccaac ggcccggcgc ccacggcgct cgccgagatc       540
     gcgatcaagg tgtccggcgg ggagatcacg caggcctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page