(data stored in ACNUC7421 zone)

EMBL: CP001700.PE419

CP001700.PE419       Location/Qualifiers
FT   CDS_pept        complement(471902..473704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0422"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: sma:SAV_2262
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69374"
FT                   /db_xref="GOA:C7PVL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69374.1"
FT                   /translation="MSGWIVPGYTETGILGAGATGRVVAAVHDATGTEVAIKYLSPRFV
FT                   NNPDFIERFREEAALLAEIRHPNVVQLFEYAESDEGSAMVMELVSGPTLHRMLHENGRM
FT                   APEAALSVMRGSLLGLGAAHQMGIVHRDYKPSNVLLNAYGISKLADFGVAERAEPVSEI
FT                   DPDATMPGGTGTPAYMAPEQWDGAPAQPVTDIYAVTASFFECLTGKVPFSADTVYELEE
FT                   KHRTAPIPLDDVPEGVQPLVAHGLAKDPAERPQDVWAFVAEVERAATDAYGVDWEERGR
FT                   QDIVALWPLFGFFVPGGAAGGGGALETLGIGPNGPADPGEPGDLDAPHASGPEDDDWDD
FT                   GHGSHRSRLPDKVKTAAIVAGVAAVVLAIAAVAVAGNGKPAKKASPPSSTSSVFTPTPD
FT                   GPTGTPTSNDAGSAPTVAVSSSSSGSGSSSSSGSSSSSSGSSSSSSSSSRSSSSSPSTK
FT                   PSSKPSTSPSSVSLPSTPSTSSPSSSPSTPSTSTSSSPQVSIGATVSVVSDPPGQCVAS
FT                   YNVTFAVGNAPGGTVVVNYTWHLASGRLVPEGPVTLKSNSSQGFGIRETSNGTPKGSVV
FT                   FVTWTTASSSGTSNSAPVSITCLK"
     ttgtctggct ggattgttcc cggctacacg gaaaccggga tcttaggcgc cggcgcgacc        60
     ggcagggtag tggcggccgt ccatgacgcg accggcaccg aagtcgcgat taaatacctg       120
     agtccgcggt tcgtgaacaa cccggacttc atcgagcgct tccgcgagga ggcggcgctg       180
     ctggccgaga tccggcatcc gaacgtggtc cagctcttcg aatacgcgga gtcggacgag       240
     ggctcggcga tggtgatgga gttggtctcc gggccgaccc tgcaccgcat gctgcacgag       300
     aacggccgca tggcgccgga ggcggcgctg tcggtgatgc gcggctcgct gctgggcctg       360
     ggcgccgcgc accagatggg catcgtgcac cgcgactaca agccgtcgaa cgtgctcctc       420
     aacgcctacg gaatcagcaa gctggcggac ttcggcgtcg ccgagcgcgc cgagccggtc       480
     agcgagatcg acccggacgc caccatgccc ggcggcaccg gcacaccggc gtacatggcg       540
     ccggagcagt gggacggcgc accggcccag ccggtgacgg acatctacgc ggtgaccgcg       600
     tcgttcttcg agtgcctgac cggcaaggtc cccttctccg cggacaccgt ctacgaactc       660
     gaggagaagc accgcaccgc gccgatcccg ctggacgacg tgcccgaagg cgtgcagccg       720
     ctggtcgcgc acggcttggc gaaggacccc gccgagcggc cgcaggacgt gtgggcgttc       780
     gtcgccgaag tcgagcgcgc cgcgaccgac gcctacggcg tggactggga ggagcgcggc       840
     cggcaggaca tcgtcgcgct gtggccgctg ttcgggttct tcgtcccagg cggcgcggcc       900
     ggcggcgggg gcgcactgga gacgctggga atcggcccga acggtcccgc cgatccgggc       960
     gagcccggcg acctggacgc accgcacgcc tccggtcccg aggatgacga ctgggacgac      1020
     ggccacggct cacatcgcag ccgcctgccg gacaaggtga agacggcggc catcgtcgcc      1080
     ggcgtggcgg cggtcgtcct cgcgatcgcc gcggtggccg tcgccggcaa cggcaagccc      1140
     gcgaagaagg ccagcccgcc gagctcgaca tcgtcggtgt tcacgccgac ccccgacggc      1200
     ccgaccggca cgccgacgag caacgacgca ggctccgcgc cgacggtcgc ggtgtcgagt      1260
     tctagttcgg gttcgggttc gagttcgagt tcgggttcta gttcgagctc gtcgggctcc      1320
     agctcgagct cgagttccag ctcccggtcg agctcatcgt cgccctcgac gaagccgtcc      1380
     tccaagccct cgacatcgcc gagttcggtg tcgctgccga gcacgccgtc gacgagcagt      1440
     ccgtcgtcct cgccgagcac gccctcgacg agtacttcat cgtcgccgca ggtgtcgatc      1500
     ggtgcgacgg tgtcagtagt gagcgatccg cccgggcagt gcgtcgccag ctacaacgtg      1560
     acattcgcag tgggtaacgc gccgggcggc accgtggtcg tcaactacac ctggcatctc      1620
     gcgagcggtc gcctcgtccc tgaaggaccg gtcacactca agtcgaacag ctcacaagga      1680
     ttcgggatca gagagacctc caacggaact ccgaagggca gcgtcgtctt cgtgacctgg      1740
     acgaccgctt cgagcagtgg cacatcgaac agcgcgccgg taagcatcac ctgtctcaag      1800
     tag                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page