(data stored in ACNUC7421 zone)

EMBL: CP001700.PE42

CP001700.PE42        Location/Qualifiers
FT   CDS_pept        complement(44241..45053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0042"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   sgr:SGR_3719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68997"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ8"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACU68997.1"
FT                   /translation="MASGRDQLDEPESADGPEPAGGPAPRPRSRVAWHTGVVLVFALAG
FT                   ALFLTARDTADGQGDIRPDRGAQLSDVIRAQNTHNQQLTEQVAGQRADQDALTRGQSAD
FT                   ARVKAVQDQVDALAAPVALTPVSGSALAVTLNDAPPNAQPAAGAPTAQPDWLIIHQQDV
FT                   QAVVNALWAGGATGIQLMDQRLAPTSAVRCVGNTLLLQGRVYSPPYVITAVGDTAKLRS
FT                   SLLAAPAVQTYLEYVSAYGLGWDVKARDRVTLPGYTGPLDVSFASVAP"
     atggcgtcag ggcgcgatca gctggacgaa cccgaatcgg cggacggccc ggagccggcc        60
     ggcgggcccg ccccccgacc gcggtcgcgg gtggcctggc acaccggggt ggtcctggtg       120
     ttcgccctcg ccggagcgct gttcctgacg gcccgggaca ccgccgacgg gcaaggcgac       180
     atccgtccgg accggggtgc ccagctctcc gacgtgatcc gggcccagaa cacccacaac       240
     cagcagctta ccgagcaggt ggccgggcag cgcgcggacc aggacgcgct gacccgcggg       300
     cagagcgccg acgcccgggt caaggcggtc caggaccagg tcgacgcgct ggccgcgccg       360
     gtggccctga ccccggtcag cggctcggcg ctggccgtga ccctcaacga cgcgccgccg       420
     aacgcccagc cggccgccgg ggcgccgacg gcgcagccgg actggctgat catccaccag       480
     caggacgtgc aggccgtggt gaacgcgctg tgggccggcg gcgcgaccgg gatccagctg       540
     atggaccagc gcctggcgcc cacctcggcg gtccgctgcg tcgggaacac cctgctgttg       600
     cagggccggg tctactcccc gccgtatgtg atcaccgcgg tcggcgacac ggcgaaactg       660
     cgctcctcgc tgctggccgc cccggcggtg cagacctatc tggaatacgt cagcgcgtac       720
     gggctcgggt gggacgtgaa ggcacgcgat cgagtgacgc tcccgggcta caccggaccg       780
     ctcgacgtgt cgttcgcctc tgtggcgccg tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page