(data stored in ACNUC7421 zone)

EMBL: CP001700.PE420

CP001700.PE420       Location/Qualifiers
FT   CDS_pept        complement(473819..474556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_6625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69375"
FT                   /db_xref="GOA:C7PVL9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL9"
FT                   /inference="similar to AA sequence:KEGG:SAV_6625"
FT                   /protein_id="ACU69375.1"
FT                   /translation="MTSMAGSTPERRRSWVRGRLRDGKVAREGGVQKGRVREGRVRRFT
FT                   VAERMVHRGTGVLMLLCVATAACLYIGPLAQAVGRRHLMVTVHEWSGILLPAPVLLGLL
FT                   SPAFRADLRRLNRFAPADRHWLRAVRRRLMEPPDRPAGKFNAGQKLYAGWIAGAVLVMM
FT                   FTGLLMWFTHLLPGISRTSSIFVHDILAWGIAVVLLAHMRKAYQDPESRRGMRTGYVDR
FT                   VWAKRNHSEWLAKDEPDGSHQQV"
     atgacgtcga tggctggctc gacgcctgag cggcggcgca gttgggtgcg cggcaggctg        60
     cgggacggca aagtggcgcg ggagggcggg gtgcagaagg gcagggtgcg cgagggcaga       120
     gtccgccgct tcaccgtcgc cgagcggatg gtccaccgcg gcaccggcgt gctgatgctg       180
     ctgtgcgtgg cgaccgcggc gtgcctgtac atcgggccgc tggctcaagc tgtgggccgg       240
     cggcatctca tggtcactgt gcacgagtgg tccggaatcc tgctgcccgc accggttttg       300
     ctcgggctgc tctcgccggc gttccgcgcc gacctgcgta ggctgaaccg cttcgcaccc       360
     gcggaccggc actggctccg ggcggtccgc cgccgtctga tggagccgcc ggaccgtccc       420
     gccggcaagt tcaacgccgg gcagaagctc tatgcgggct ggatcgccgg cgcggtactg       480
     gtgatgatgt tcaccgggct gctgatgtgg ttcacgcacc tgttgccggg catctcccgg       540
     acgagttcca tcttcgtgca cgacatcctt gcctggggca tagccgtcgt actgctggcg       600
     cacatgcgca aggcatatca ggatccagag tcacgacggg gtatgcggac cggatacgtg       660
     gaccgggtgt gggctaagcg caatcattcc gagtggctcg cgaaagacga accagacggt       720
     tcgcatcagc aggtataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page