(data stored in ACNUC7421 zone)

EMBL: CP001700.PE421

CP001700.PE421       Location/Qualifiers
FT   CDS_pept        complement(474528..475229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0424"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   sma:SAV_6624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69376"
FT                   /db_xref="GOA:C7PVM0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM0"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACU69376.1"
FT                   /translation="MPDSEAENTPDGAPLARRTLFGVLGAGAAGLIAAPYLQAGWEKVL
FT                   AKASEDDPTGLSGLLPNPGGFRYYSVVGSVPRKDETNYELRIGGLVDRARSYTLADLRA
FT                   LPQTRIVHDVQCTDGWRVEKTPFEGVRLSDLLDDAGVAGNGKALRFTCFDGAYSESLTL
FT                   EQARRDDVLIALQMQDAPITHDHGGPVRLYVAPMYFYKSAKWLSGISVTDRVVPGYWEE
FT                   RGYDVDGWLDA"
     atgccggatt ctgaagcgga gaacacgcct gatggtgctc ccctggcgcg tcggacgttg        60
     ttcggcgtgc ttggtgcggg ggcggcgggg ttgattgcgg cgccgtattt gcaagccggg       120
     tgggagaagg tgctcgcgaa ggcgtctgag gatgatccga ccgggctgag tgggctgctg       180
     ccgaatccgg gcgggtttcg gtactacagc gtcgtcggct cggttccgcg gaaggatgag       240
     accaactacg agttgcggat cggcgggctg gtcgatcggg cgcggagtta cacgctggcg       300
     gacctgcggg cgctgccgca gacgcggatc gttcacgatg tgcagtgcac ggacgggtgg       360
     cgcgtggaga agacgccgtt cgaaggcgtg cggctctcag atctgctgga tgacgcgggg       420
     gtcgccggga atggcaaagc cctgcgtttc acctgcttcg acggcgccta cagcgagagc       480
     ctgacgctgg agcaggctcg gcgcgacgac gtgctcatcg ccctgcagat gcaggacgcg       540
     ccgatcacgc acgatcacgg cggtccggtg cggctctatg tggcgccgat gtacttctac       600
     aagtccgcca aatggctgtc cggcatatcg gtcacggacc gggtcgttcc cggctactgg       660
     gaggagcgcg gctatgacgt cgatggctgg ctcgacgcct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page