(data stored in ACNUC7421 zone)

EMBL: CP001700.PE422

CP001700.PE422       Location/Qualifiers
FT   CDS_pept        475544..476416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0425"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   nca:Noca_3836 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69377"
FT                   /db_xref="GOA:C7PVM1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69377.1"
FT                   /translation="MTSLRLADGRNLEYLVAGPDGGTPLVFHHGTPFAAVLFEPMVEAA
FT                   TRHGLRFVVHSRPGYADSSPQPGRTIASVAEDVAALLAALDAERFLTVGWSGGGPHALA
FT                   CAALLPERCVAAATVAGVAPYRAEGLDWLDGMGAENIEEFAAAVSGAAPLTEFLSAQAA
FT                   GLANVQGADIAAALGELISEVDGRALSDAFADFTAAAFRKAVSAGIDGWHEDDLAFIGD
FT                   WGFDLAAIKTPVSVWQGDEDRMVPFAHGRWLAGALPGAAAQLLPNEGHLSLVLDRFDDV
FT                   VADLVKRLP"
     atgaccagtc ttcgccttgc agacggccgg aatctcgaat acctggtagc cgggcccgat        60
     ggcgggacgc cgctcgtctt tcatcacggc acgccgttcg cggcggtgct gttcgagccg       120
     atggttgagg cggcgacgcg gcacgggttg cgcttcgtcg ttcacagccg ccctgggtac       180
     gccgactcct cgccgcagcc gggccgcacc atcgcctcgg tggccgagga cgtcgcggcg       240
     ttgctggcgg cgctggacgc cgagcgcttc ctgaccgtcg gctggtccgg gggcggtccg       300
     catgccttgg cctgcgcggc gctgctgccg gagcggtgtg tggcggcggc gaccgtggcc       360
     ggtgtcgcgc cgtaccgtgc cgagggtctg gactggctgg acgggatggg tgcggagaac       420
     atcgaggagt tcgcggcggc ggtgtccggt gctgcgccgt tgaccgaatt cctgagtgcg       480
     caggcggctg ggcttgcgaa cgtgcagggc gcggacatcg ccgcggcgct gggtgaactg       540
     atctccgagg tcgacggcag ggcgctgagc gacgcgttcg ccgatttcac ggcggcggcg       600
     ttccggaagg cggtgtccgc cggcatcgac ggctggcacg aggacgacct ggcgttcatc       660
     ggcgactggg gtttcgacct cgccgcgatc aagacgccgg tctcggtctg gcagggggac       720
     gaggaccgca tggtcccgtt cgcgcacggc cgctggctcg ccggcgcgct gcccggcgcc       780
     gccgcacagc tgctgccgaa cgagggacac ctgtcgctcg tgctcgaccg gttcgacgac       840
     gtcgtcgccg acctcgtcaa gaggctgccc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page