(data stored in ACNUC7421 zone)

EMBL: CP001700.PE423

CP001700.PE423       Location/Qualifiers
FT   CDS_pept        476447..476965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0426"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: rha:RHA1_ro03342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69378"
FT                   /db_xref="GOA:C7PVM2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM2"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACU69378.1"
FT                   /translation="MLETPEELAALQTLLDDSAAAAGPHMRGIFTDDRRLNAAELSARL
FT                   QGMCLIAVATVTADGRPLTGPFDGYFLHGSWWFSSAPDSVRIRHLQARPGVSATYLPGE
FT                   ELSVTAHGRAELFDLHAPECDDLRQAMLDFYLPKQGPAFQEWMDGLEGGIGVRIDARKL
FT                   FTFFASSTA"
     atgctcgaga cccctgaaga actggccgct ctgcagaccc tcctcgacga cagcgccgcc        60
     gctgccggtc cgcacatgcg cggcatcttc acggacgatc gccgcctgaa cgccgccgag       120
     ctgagcgcgc gcctgcaagg gatgtgtctc atcgcggtgg cgacggtgac cgccgacggg       180
     cgtccgctca ccggaccgtt cgatggctac ttccttcacg gctcgtggtg gttcagctcc       240
     gcgcccgatt ccgtgcggat ccggcacttg caggcgcgtc cgggggtgag cgcgacgtac       300
     ctgccggggg aggagctgtc ggtgacggcg cacggccgcg ccgagctgtt cgacctgcac       360
     gcgccggagt gcgacgacct gcgccaggcg atgttggact tctacctgcc gaagcaggga       420
     ccggccttcc aggagtggat ggacggtctc gagggcggca tcggcgtgcg catcgacgct       480
     cggaagctct tcacgttctt tgcctcctcg accgcgtaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page