(data stored in ACNUC7421 zone)

EMBL: CP001700.PE424

CP001700.PE424       Location/Qualifiers
FT   CDS_pept        477158..477562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0427"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3738 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69379"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM3"
FT                   /inference="similar to AA sequence:KEGG:SCO3738"
FT                   /protein_id="ACU69379.1"
FT                   /translation="MRTRSLLTTLACAAVMVGAGAESAFADATPTTQPSAVPTRSAAPS
FT                   VPPTTAPTATAMPSAVPSDSARTAAPATPPPTLPGRQVGAVPSGAPNTGEPVAASKGHG
FT                   EAEAVGASLALLLAGSGSVMVRRRKLKGRG"
     atgcgtactc ggagtttgct caccaccctg gcgtgcgccg cggtgatggt tggagccgga        60
     gccgaatcgg cgttcgccga cgccaccccc accacccagc cctccgctgt gcccacccgc       120
     agcgcggcgc cctccgtgcc gcccacgacg gcgcccaccg cgaccgcgat gcccagcgcc       180
     gtgccgagcg actcggcccg taccgccgcc ccggccacgc cgccgccgac cctgccgggc       240
     cgccaggtcg gcgcggtccc gtcgggcgcg ccgaacaccg gcgagccggt ggcggcgtcc       300
     aaggggcacg gcgaggctga ggcggtcggc gcctccctgg ccctgctgct cgccggttcg       360
     ggctcggtga tggtccgccg ccgcaagctc aagggccggg gctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page