(data stored in ACNUC7421 zone)

EMBL: CP001700.PE425

CP001700.PE425       Location/Qualifiers
FT   CDS_pept        477565..478272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0428"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   sma:SAV_92 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69380"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM4"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACU69380.1"
FT                   /translation="MRRAWTRGWPAVIAALLLASGCAAGSSTSAGGSGRNAGGTGTNPA
FT                   AATAGGPAGSQAGGTAGTPAGGTSGTSSAGNSTSAGAIARSDPVRLQIPAIGVDTSVMA
FT                   LGLAADGTVQVPPIEKDSPAGWYNGSPTPGQTGPSVILGHVTVGKYGDGVFLKLAQLKP
FT                   GAHVVVRLQDGASADFTVDSVRTVAKAQFPTQEVYGNVNRPELRLITCGGERTSDGYLD
FT                   NVLVFASLTGTAG"
     ttgcggcggg cctggacgcg cggatggccg gctgtcatag ccgcccttct gttggcttcc        60
     ggctgcgcgg ctggttcgag cacgtctgcc ggcggatctg ggaggaacgc cggcgggacc       120
     gggacgaatc cggctgcggc cacggccggt gggccggcgg gcagccaggc gggcggtaca       180
     gcgggcactc cggccggcgg cacgtcggga acctcgtcgg cgggcaactc gacgtccgcc       240
     ggcgcgatcg cgcgctccga cccggtccgg ctgcagatcc ccgccatcgg cgtcgacacc       300
     tcggtgatgg cgctcgggct ggccgccgac ggaaccgtcc aggtcccgcc gatcgagaag       360
     gacagcccgg ccggctggta caacggttcg cccactccgg ggcagaccgg accgtcggtg       420
     atcctcggtc atgtgacggt cggcaagtac ggcgacggcg tgttcctgaa gctggcgcaa       480
     ctgaaacccg gagcccacgt cgtggtccgg ctgcaggacg gagcctcggc cgacttcacc       540
     gtggacagcg tgcgcaccgt cgccaaggcc cagttcccga cccaggaggt ctatgggaac       600
     gtcaaccggc cggaactgcg tctgatcacg tgtgggggag agcggaccag cgacggctac       660
     cttgacaacg tgctggtctt cgcatccctg accggcactg cgggatag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page