(data stored in ACNUC7421 zone)

EMBL: CP001700.PE426

CP001700.PE426       Location/Qualifiers
FT   CDS_pept        478313..478825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0429"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: sco:SCO3736 RNA polymerase ECF sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69381"
FT                   /db_xref="GOA:C7PVM5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM5"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU69381.1"
FT                   /translation="MSRSKDSGEKSRAASDLFTDLYPGLAGWCRRLVDDDGTAHEIASE
FT                   AFTRLWGHWTSVREPRGFLYVTAANLVRDHWRKMDRERRAIRQVSAEVERAAHHDGADA
FT                   SVSVRMLVRSLPERLRTPVLLYYYADLPIREIAQLTRRKEGTVKSDLHAARELLRAGLG
FT                   GHLDHAH"
     ttgagccggt ccaaggattc cggagagaag agtcgggcgg cgtccgactt gttcaccgat        60
     ctctatcccg gcctcgcggg ctggtgccgc cgtctcgtcg acgacgacgg caccgcccac       120
     gagatcgcct ccgaggcgtt cacgcgcctg tgggggcact ggacctcggt gcgggaaccg       180
     cggggcttcc tgtacgtgac ggccgcgaac ctggtccgcg accactggcg caagatggac       240
     cgcgaacgcc gggcgatccg gcaggtgagc gcggaggtcg agcgcgccgc gcaccacgac       300
     ggcgccgacg cgtccgtctc ggtgcggatg ctggtgcggt cgctcccgga gcggctgcgg       360
     acgcctgttc tgctgtacta ctacgccgat cttccgatcc gcgagatcgc ccagctgacc       420
     aggcgcaaag aaggaaccgt caaatccgat ctacacgcgg cacgggaact cctgcgcgcc       480
     ggactcggag gacatcttga tcacgctcat tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page