(data stored in ACNUC7421 zone)

EMBL: CP001700.PE427

CP001700.PE427       Location/Qualifiers
FT   CDS_pept        478809..479513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_94 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69382"
FT                   /db_xref="GOA:C7PVM6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69382.1"
FT                   /translation="MITLIEPADDDDDAVTGDQGGVGGVGGARGSGGDGDSDSDSFGYS
FT                   IEGDDGDGDELVVLLRPGVSVLAPPAGAFQRIRRRAARRRLARAAATVGAGAAMAAVAV
FT                   TVALWPSNSALGPPAPVSPVAPPVQRTSIPDAPATTPLTSSSPSPSPSSLPSSSPSPTP
FT                   QRPHAGPSDSAAPPTAPPSTAVRTAPTRVPTTRPATAATPSTPPRTEGSVTPEGSATPA
FT                   GRATPTCPSGCG"
     ttgatcacgc tcattgagcc cgcggacgat gacgacgacg ccgtcaccgg cgaccagggc        60
     ggcgtcggcg gggtcggcgg cgcgcgcggc agcggcggtg atggcgacag cgacagcgac       120
     agcttcggct acagcatcga aggcgatgac ggcgacggcg acgaactggt cgtgttgctg       180
     cgccccggag tctcggtgct cgcaccgccg gccggtgcgt tccagcggat ccggcggcgc       240
     gccgcccggc gtcgtctggc tcgggccgcg gccacggtcg gcgcgggtgc ggcgatggcg       300
     gccgtcgcgg tgaccgtcgc cctgtggccg tccaacagcg cgctcggtcc gccggcgccg       360
     gtgtcgccgg tggctccgcc ggtccagagg acttccattc ccgacgcgcc tgcgacgact       420
     cccctcacca gctcgtcgcc gtcgccgtca ccgtcgtcct tgccatcgtc ctcgccgtcg       480
     ccgactcccc agcgtcccca cgccggcccg tccgacagcg cggctccccc cacggctccc       540
     ccgtcaacgg cggtccgcac cgcgcctacg cgagtcccca ccacgcgtcc ggcgaccgcc       600
     gcgacaccta gcactcctcc gcgcaccgag ggaagcgtca cgcccgaggg aagcgccaca       660
     ccggcgggaa gggctacgcc gacgtgccct tcgggatgcg gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page