(data stored in ACNUC7421 zone)

EMBL: CP001700.PE428

CP001700.PE428       Location/Qualifiers
FT   CDS_pept        479655..480716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0431"
FT                   /product="Carbohydrate-binding family V/XII"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; 3D domain
FT                   protein; SMART: Carbohydrate-binding family V/XII; KEGG:
FT                   sgr:SGR_6088 putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69383"
FT                   /db_xref="GOA:C7PVM7"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM7"
FT                   /inference="protein motif:PFAM:PF02839"
FT                   /protein_id="ACU69383.1"
FT                   /translation="MSLFPIRRRIPEHAPSRRPGPRLRALLGAVALTLTAFGAVGVVAA
FT                   QQASAAGTSSLPTCPFWTNVTPPPRTDTPWVPPLQTAQPVNFSSRLAAPGGVTGTLTGS
FT                   QVDISFNRVAGAQAYRVWRNGQAIAWVSDWGQPALTAVDNAPCQNAYYTFEAMSDQSGA
FT                   DSSLGQMSSPYQLNSDGAVVPWQIPVGSTVTMMVTSYNDGGMTASGYNSQLGVCAVDPR
FT                   VIPWGTYFTVPGYGTCYAADIGTWIQNDTVDVWLPGSQANGWGVQHRTVTIIANPFGGP
FT                   TPPPSSSPSSSPTSSPSSPPGGCTTAAWNSATAYTGGQTVSYGGHTWTAKWWTQGDVPG
FT                   ANSQNVWTDDGPC"
     atgagcctgt tccccatcag gcgacgaata cccgagcacg ccccgagccg ccggcccggc        60
     cctcgtctgc gagcactgtt gggcgctgtg gccctgacgc tcacagcctt cggcgcggtc       120
     ggagtcgtgg ccgctcagca agccagcgcc gcgggtacct cctcgctgcc gacctgcccg       180
     ttctggacca acgtcacccc gccgccgcgg accgacaccc cgtgggtgcc gccgctacag       240
     accgctcagc cggtcaactt ctcctcgcgg ctggccgccc ccggcggcgt caccggcact       300
     ttgaccggca gccaggtcga catctcgttc aaccgcgtcg ccggcgcgca ggcctaccgg       360
     gtctggcgca acggccaggc catcgcatgg gtctccgact gggggcagcc ggccctcacc       420
     gcggtcgaca acgcgccatg tcagaacgct tactacacct tcgaggcgat gagcgaccaa       480
     agcggcgccg actcctcgct gggccagatg tcctcgccct accagctgaa ctccgacggc       540
     gcggtggtgc cgtggcagat cccggtcggc agcaccgtca ccatgatggt cacctcctac       600
     aacgacggag ggatgacggc gtccggctac aactcgcagc tcggagtgtg cgcggtcgat       660
     ccgcgggtga tcccgtgggg cacgtacttc accgtgccgg gctacgggac ctgctacgcc       720
     gccgacatcg ggacgtggat ccagaacgac accgtcgacg tctggttgcc gggctcgcag       780
     gcgaacggtt ggggcgtgca gcatcgcacg gtcacgatca tcgccaaccc gttcggcgga       840
     ccgacgccgc cgccaagcag ttctccgtcc agctcgccga cgtcctcgcc gagctcgcct       900
     cccggcggct gtaccactgc ggcctggaac tccgcgacgg cctacaccgg cggccagacc       960
     gtcagctatg gcggccacac ctggacggcc aagtggtgga cccagggtga cgtccccggc      1020
     gccaactccc agaacgtctg gacggacgac ggaccatgct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page