(data stored in ACNUC7421 zone)

EMBL: CP001700.PE429

CP001700.PE429       Location/Qualifiers
FT   CDS_pept        480710..482398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0432"
FT                   /product="cellulose-binding family II"
FT                   /note="PFAM: cellulose-binding family II; Fibronectin type
FT                   III domain protein; SMART: cellulose-binding family II;
FT                   Fibronectin type III domain protein; KEGG:
FT                   fre:Franean1_6988 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69384"
FT                   /db_xref="GOA:C7PVM8"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM8"
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /protein_id="ACU69384.1"
FT                   /translation="MLRALRASLIAAGAGALLVSGLTIASPTASAATTPTPTATAPTTP
FT                   TATAPTTPTPLPTAVYSKTSDWGSGFQAQYVITNPMSVPLNTWSLQFSLPSTEKITSMW
FT                   GGTDTASGTTHTVLAQSYDTTIAAGASITIGFDGSYSGTYADPSACKLNSDPCDGSADA
FT                   QAPTAPTALTTLSTTSSAASLSWTGSADNVTVAGYNVYSGSTMVATSPGTAATVTGLAP
FT                   STSYSFTVRAVDEAGNLSAPSAAVSATTLASTGGGHLPGVAAPFVDIGAWPTPNLTQIA
FT                   ETTGLRQFSLGFIVNGTATCTPSWFNAYAMSAGFEQSDIATLRAIGGDVKPSFGGEAGT
FT                   ELAQSCTDVPSLTAAYQSAITAYNLTQIDFDIEGSAVADPASIDRRSQAIAALQKNAAA
FT                   AGKPLTVTLTLPILPSGLTTDGLYVVQSAVKYGAKITTVNGMAMDFGDIEAPNPSGKMG
FT                   TYAIDTAQSLHTQLTPLYPALTATQLWNMIGVTPMIGQNDNSSEVFYQTDMHQLLTFAQ
FT                   QQHLGELAFWDVTRDANACTGSLSKCTDIPQTPYEFSKMIAPYQG"
     atgctgaggg ctctccgagc aagcctgatc gctgctggcg ccggcgctct gctggtcagc        60
     ggcctgacaa tcgcctcccc gacagcttcg gccgccacga ccccaacccc gaccgccacc       120
     gcgcccacca ccccgaccgc caccgcgccc accaccccga ccccgttgcc caccgccgtc       180
     tacagcaaga cctccgactg gggcagcggc ttccaggcgc agtacgtgat caccaacccg       240
     atgtccgtcc cgctgaacac ctggtcgctc cagttcagcc tgccgtccac cgagaagatc       300
     accagcatgt ggggcgggac cgacaccgcg agcggtacca cgcacaccgt cctcgcgcag       360
     tcctacgaca ccacgatcgc ggccggcgcg tcgatcacca tcggtttcga cggcagctac       420
     tcggggacgt acgcggaccc gtccgcctgc aagctcaact cagacccctg tgacggcagc       480
     gcggacgccc aagccccgac cgcgccgacg gcactgacca cgctgagcac cacctcgagc       540
     gccgcgtcgc tgtcctggac cggctccgcc gacaacgtca cggtcgccgg gtacaacgtg       600
     tattcgggtt cgacgatggt cgccacgtcc ccgggcacgg cggcgaccgt caccggtctg       660
     gcgccctcga cgtcctactc gttcaccgtc cgcgccgtcg acgaagccgg gaacctgtcg       720
     gcgccgagcg cagcggtcag cgccacgacg ctggcaagca ccggcggcgg acacctgccc       780
     ggcgtcgccg cgcctttcgt cgacatcggc gcctggccca ccccgaacct gacccagatc       840
     gccgagacga caggcctgcg ccagttctcc ctcggcttca tcgtcaacgg cacggccacc       900
     tgcaccccga gctggttcaa cgcctacgcc atgtccgccg gcttcgagca gtcggacatc       960
     gccaccctgc gcgcgatcgg cggcgacgtg aagccgtcct tcggcggcga ggcgggcacc      1020
     gaactggcgc agtcgtgcac cgacgtcccg tccctgacag ccgcctacca atcggccatc      1080
     accgcctaca acctcaccca gatcgacttc gacatcgagg gctccgcagt cgccgacccc      1140
     gcctccatcg accgccgctc ccaagccata gccgccctgc agaagaacgc agccgcagcc      1200
     ggcaagcccc tcaccgtcac cctgaccctc ccgatcctcc cctccggcct caccaccgac      1260
     ggcctctacg tagtccagtc agcagtgaag tacggcgcca agatcaccac agtcaacggc      1320
     atggccatgg acttcggcga catagaagcc cccaacccca gcggcaagat gggcacctac      1380
     gccatcgaca cagcccaatc actccacacc caactgacgc ccctctaccc agccctcacc      1440
     gcaacccagc tgtggaacat gatcggcgtc acccccatga tcggccagaa cgacaactcc      1500
     tccgaagtct tctaccaaac cgacatgcac caactcctca ccttcgccca acaacaacac      1560
     ctcggcgaac tagccttctg ggacgtcacc cgcgacgcca acgcctgcac cggctccctg      1620
     tcaaagtgca cggacatccc acagaccccc tacgagttct ccaagatgat cgcgccctat      1680
     caaggctga                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page