(data stored in ACNUC7421 zone)

EMBL: CP001700.PE43

CP001700.PE43        Location/Qualifiers
FT   CDS_pept        45132..45386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0043"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   sma:SAV_4331 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68998"
FT                   /db_xref="GOA:C7QFQ9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACU68998.1"
FT                   /translation="MPESKVRKKAAYTPPPDKKQPIKLDTGNRVVLPLMVGCFVLGLLW
FT                   IVIYYLSNMTYPVSALHGWNMAVGFGLIITGFIASMRWK"
     gtgcccgagt ccaaggtccg caagaaggcc gcgtacaccc cgccgccgga caagaagcag        60
     ccgatcaagc tggacaccgg gaaccgggtg gtgctgccgc tgatggtcgg gtgcttcgtg       120
     ctcggcctgt tgtggatagt gatctactac ctgtcgaaca tgacgtaccc ggtgtcggcg       180
     ctgcacggct ggaacatggc cgtcggcttc ggtctgatca tcaccggctt catcgcctcg       240
     atgcggtgga agtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page