(data stored in ACNUC7421 zone)

EMBL: CP001700.PE430

CP001700.PE430       Location/Qualifiers
FT   CDS_pept        482489..482917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69385"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM9"
FT                   /inference="similar to AA sequence:KEGG:gll3649"
FT                   /protein_id="ACU69385.1"
FT                   /translation="MDVVGEALPAIISAVRTYGDTVLTAGEQAAASGTVSLGRRLLQKL
FT                   FGGAPKPVVFEDAVANLAAAPESDDAVAALRLQIGNVLARHPELRDEIAAMLPHQTGNT
FT                   VSGDGSANAGRDQNISASGGTAVGVLNIHPSSPDPTTR"
     atggacgtag tgggggaggc tctgcctgcg atcatcagcg ccgtcagaac ctatggcgac        60
     accgtgctga ccgccggaga gcaggccgcg gcgagcggga cggtgtcctt ggggcggcgg       120
     ttgcttcaga aactgttcgg gggcgcgccg aagccggtcg tgttcgagga cgcggtggcg       180
     aatctggcag cggcgccgga gagcgatgac gcggtcgcgg cgctgcggct tcagatcggc       240
     aacgtgctcg cgcggcatcc cgagctgcgc gatgagatcg ccgcgatgct gccgcaccag       300
     accgggaaca ccgtgtccgg tgacggttcg gccaatgccg gacgtgacca gaacatctcc       360
     gccagcggcg gcaccgctgt cggcgtgctc aacatccacc cttcctcgcc ggatccgacc       420
     acgcgatag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page