(data stored in ACNUC7421 zone)

EMBL: CP001700.PE431

CP001700.PE431       Location/Qualifiers
FT   CDS_pept        483007..485148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0434"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="KEGG: fra:Francci3_0876 putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69386"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN0"
FT                   /inference="similar to AA sequence:KEGG:Francci3_0876"
FT                   /protein_id="ACU69386.1"
FT                   /translation="MAAAFTATGVPQVQVLFGLGGVGKTSVAVEYAYRFADSYGIVWQF
FT                   SAEHPESLDGQIGELAAHLGLLVPPTTDDAAGSLRSHLVNADRPWLLVLDNVVDDAVVH
FT                   RLVPAAGPGHVVVTSQRATWPGRARVREVPVLDRDVAIKYLLSAADSSDVAASGLLVDA
FT                   LGGLPLALAHAAAFLRVTGRPVQFYLDKLSAMLVRPGRGKAVARTWSAAIGQLGSAGSP
FT                   AMALLRVLACFAPDAIPVRLLFPDDAPVPEGLSADVADQLAALADDGLAVDDALIALRE
FT                   FSLVGSPVGDGVVSIHRLVQAATLEAMSPEEQSAWRQAATALVVRATPDDPNLPETWPA
FT                   FTALLRHIEQVVPAEHDCYLRAADHLGAVGNYRAAVAMARRSLEARARRQGPDAPETLA
FT                   ARQSTAQWTGHAGDFEGARDQCADLLPIRERLLGVEHPDTLSTRSVLAFWTARAGSYAA
FT                   ARNQGIDLLSIRERVLGIEHPDTLLTRSNLAGWTGNAGDPAGARDQFADLLPRYQHVLG
FT                   DEHPVTLITRTHLARWVGEAGDPAGARDRFADVLPIRERVFGAEHPDTLHVRANLARWT
FT                   GKAGAAAEARDQYAVLLPLFERVLGPEHPATLTNRRNLAHWTGKAGDAHGAREQLVALL
FT                   PLHQRVLGPEHVSTLHARHNLARWTKNAGDNAGARDQFTDLLPIRERVLGSEHLDTVKT
FT                   RNGLASCITETERVPGATE"
     gtggcggcgg ctttcactgc caccggcgtt ccgcaggttc aggttctctt cggccttggg        60
     ggagtcggca agaccagcgt ggcggtggag tacgcctatc ggttcgccga ctcgtacggg       120
     atcgtctggc agttcagcgc cgaacacccc gagtccctgg acggacagat cggtgagttg       180
     gccgcgcatc tgggtctact tgttccgccg acaacggacg acgcagcagg ttcactcagg       240
     tcacacctgg tgaacgccga tcgcccctgg ctgctggtgc tggacaacgt ggtggacgac       300
     gcggtcgtgc atcggctggt cccggccgcc gggcccggtc atgtggtggt gaccagccag       360
     cgggcgacgt ggccgggacg tgctcgcgtg cgcgaggtcc cggtgttgga tcgggatgtc       420
     gccatcaaat atctgttgtc tgcggccgac agcagcgacg tggcggcctc cggactcctg       480
     gtcgacgcgt tgggcggcct gccgctggcc ttggcgcacg cggctgcctt cctgcgggtg       540
     acgggccgac cggtgcagtt ctacctggac aaactgtcgg cgatgctggt ccgccccgga       600
     cggggcaagg cggtggctcg gacttggagt gcggcgatcg gccagctggg aagcgccggc       660
     tcgcctgcta tggcgctgct gcgagtgctg gcctgcttcg caccggatgc cattccggtg       720
     cgactgcttt tccccgacga cgcgcctgtg ccggaaggac tgtccgcaga cgtcgctgac       780
     cagttggcgg ctttggccga cgacggcctg gcggtggacg atgccttgat cgcgctccgc       840
     gaattcagct tggtcggctc gccggtgggc gacggcgtgg tgtcgatcca tcggctcgtg       900
     caggccgcga ctctcgaggc gatgagccct gaggaacagt ccgcgtggcg ccaggcagcc       960
     acggccttgg ttgtgagggc aacgccggat gatcccaacc tgccggagac atggcctgcc      1020
     tttaccgcgt tgctgcgcca catcgaacaa gtcgtgcctg cggaacacga ctgctacctg      1080
     cgtgcggcag atcatctcgg tgcagtcggc aattaccgtg ccgccgtggc catggcccgc      1140
     cggagcctcg aggcgcgagc gcggcgacaa ggtcctgatg ctccggagac gcttgcggcc      1200
     cgccagagca ccgcccaatg gactggccac gccggcgact tcgaaggcgc tcgagaccaa      1260
     tgtgccgacc tactgccgat ccgcgagcga ctccttggcg tcgagcatcc cgacacgctg      1320
     tccacgcgct cggtcttggc gttttggact gcgagagccg ggagctacgc cgccgcgcgt      1380
     aatcagggta ttgacctact ctcgatccgt gaacgtgttc tcggcatcga gcatcccgac      1440
     acgctgctca cgcgcagcaa cctggccggc tggacgggca acgcggggga tccggccggt      1500
     gctcgtgacc agttcgccga tctccttccg cgctatcagc acgttctcgg cgacgaacat      1560
     cccgtcaccc tgatcacgcg gacccacctg gcacgctggg tcggagaggc gggggatccc      1620
     gccggtgccc gcgaccgatt cgcggacgtg cttcccatcc gggaacgtgt cttcggcgcc      1680
     gaacaccccg ataccctgca cgtacgcgcc aatctggccc ggtggaccgg gaaggccgga      1740
     gccgccgccg aagcccgtga ccaatacgcg gttctgctcc cgctctttga gcgcgttctg      1800
     ggacctgaac atcccgccac cttgaccaat cgccgcaacc tggcccattg gacgggaaag      1860
     gccggagacg cccacggagc ccgtgaacag ctcgtcgcgt tgctgccgct gcatcaacgc      1920
     gtcctcggcc cggagcacgt gagcactctg cacgcgcggc acaacctggc ccgctggacg      1980
     aagaacgccg gcgacaacgc cggtgcccgt gatcagttca ctgatctcct cccgattcgg      2040
     gagcgtgtcc ttggcagcga acacctggat acggtgaaga ctcgcaacgg cttggcgagc      2100
     tgcatcaccg agaccgagcg cgtccctggc gccaccgagt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page