(data stored in ACNUC7421 zone)

EMBL: CP001700.PE432

CP001700.PE432       Location/Qualifiers
FT   CDS_pept        485629..485889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K10592 E3
FT                   ubiquitin-protein ligase HUWE1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69387"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69387.1"
FT                   /translation="MVASAHAKASIKVKLGWDQAGISDVGGVEGVGSVGSADRVEDADR
FT                   VEDADSADDADDAGSDSSDGSAKAEDPAEDTAQDTAQDQEP"
     atggtggcca gtgcgcacgc caaggcttcg atcaaggtga agctgggttg ggaccaggcg        60
     ggtatctcgg acgtcggcgg tgtcgagggc gtaggcagcg taggtagtgc agacagagtc       120
     gaagatgctg acagggtcga agatgccgac agcgccgacg atgctgacga cgccggcagc       180
     gacagcagcg acggcagcgc aaaagccgaa gaccccgccg aggacacagc ccaggacaca       240
     gcccaggacc aggagcctta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page