(data stored in ACNUC7421 zone)

EMBL: CP001700.PE433

CP001700.PE433       Location/Qualifiers
FT   CDS_pept        485889..487886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69388"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69388.1"
FT                   /translation="MALAQLPNPGGPHLIAQAERSAVAVLAPEAPPEPGAEPALCLIGS
FT                   GFFITTDLVLTCAHVVADEPELYVLSGSVTLRVKAVELIDPPYDGDDSWPVPDLALLRI
FT                   EPAPPDDESDPYPVWLDLAPNASFISSAGYLSVGYDKRGPGGAAALASRLYDAGGTRKA
FT                   NAPGLPSFTYVELAGNTVPTYRSGSMVIDLSTGRVTGIVKAARAEDDGDGGYAVPLAGV
FT                   LPRVLSRQLGVQKAKDILAAHDSFHARTVDWPAMCEHYFTGPQPPGAIRADSTKLPLNE
FT                   VALLGLLVSIRHVVTDAELFEIIQSHSGLELAADAGLRDVALGLAATTTWSSTDVHSLL
FT                   RFMDGLTTRLEHRVSQQWLAEARKWADGLAAKLNQTSRLRALRMQTSAIRRTSGAAEAG
FT                   SSSLRVLVDPAFDPAGGYHVSIRMHHSAGVGAEQSPEETIGSASVLAHLRDVLPAAVRA
FT                   AARLDGGCLIDLVLPLDLLAEPVHKWEVSGSTPLGHLLPVAVRSVERYRDRDDVPGARL
FT                   REIWDRASKEAVSLQWIMCEDPENTGRAVEHTGLGLVNPPTSRHRRSRRLLDEAVQDGV
FT                   PLLVWSASDCGVDHADPQNVSVLCAGPYFQGIAEEALRDVVLEDVPHRLFAKRSQAGAE
FT                   ELDAVALFWDNPGLGHEENLLTEPCYPEDS"
     atggcgctgg cccagctgcc gaaccccggc ggtccccacc tcatcgcgca ggcggagagg        60
     tctgcggtcg cggtcctcgc gcccgaagct cctccggagc cgggcgcgga gcccgcgctg       120
     tgcctgatcg ggtcagggtt cttcatcacc accgatctgg tgctgacctg tgcccacgtc       180
     gtcgccgacg agcctgagct ctacgtcctg agcggcagcg tgaccctgcg cgtcaaagcc       240
     gtcgagctga tcgacccgcc ctacgacggc gacgactcct ggccggtgcc ggacctggcc       300
     ctgctgcgca tcgaacccgc gccgccggac gacgagagcg atccctaccc ggtgtggctg       360
     gacctcgcgc ccaacgcgtc cttcatcagc agcgccggct acctcagtgt gggctacgac       420
     aagcgcggtc ccggcggagc ggcggcgctc gccagccggc tctacgatgc cggcggcacg       480
     cgcaaggcga acgccccggg gctgccgagc ttcacctacg tcgagctcgc cggcaacacc       540
     gtcccgacat accgttccgg cagcatggtc atcgacctga gcaccggacg cgtgaccggc       600
     atcgtcaaag cagcccgcgc cgaggacgac ggcgacggcg gctacgcggt ccccctggcc       660
     ggcgtcctgc cgcgcgtact gtcgcgccaa ctgggagtcc agaaggcgaa ggacatcctg       720
     gcagcgcacg actcgttcca cgcccggacc gtggattggc ccgccatgtg cgagcactac       780
     ttcaccggtc cccagccgcc tggcgccata cgggcagact ccacaaagct ccccctgaac       840
     gaagtcgccc tcctcggtct cctggtatcg atccgccacg tcgtcaccga cgccgaactc       900
     ttcgagatca tccagagcca cagcggcctg gagctcgccg ccgacgccgg cctccgcgac       960
     gtcgccctcg gcctggccgc gaccaccacc tggagctcca ctgacgtcca cagcctcctg      1020
     cgcttcatgg acggcttgac cacgcgcctc gaacaccgcg tcagccagca gtggctggcc      1080
     gaagcgcgga agtgggctga tggtctggcc gcgaagctca accaaacctc ccgcctccgt      1140
     gccctgcgca tgcagacatc cgcaatacgc cgtacttccg gggcggcaga ggcgggtagc      1200
     agctccctgc gggtactcgt cgatccggcg ttcgatccgg cgggcgggta tcacgtcagt      1260
     atccgtatgc accacagcgc cggggtcggc gcggagcagt ctccggagga gaccatcggc      1320
     agtgcgagtg tcctggcgca tctccgcgat gtcctgcccg ccgcggtccg ggccgccgcg      1380
     cgcctggacg gcggctgcct gatcgacctc gtcctgccgc tggacctgct ggccgagccg      1440
     gtgcacaagt gggaggtctc cggctccacg ccgctcggcc acctgcttcc ggtcgcggtc      1500
     cgctcggtgg agcgctaccg ggaccgggac gacgtgccgg gcgccaggct gcgcgagatc      1560
     tgggaccggg cgtctaagga ggctgtttcg cttcagtgga tcatgtgcga ggatcctgag      1620
     aacaccggcc gggccgtgga gcacaccggg ctcgggctgg tgaacccgcc caccagccgg      1680
     caccggcgat cccggcgtct gctcgacgag gcggtccagg acggcgtgcc gctgctggtc      1740
     tggtcggcgt ccgactgcgg ggtggaccac gccgatccgc agaacgtgtc agtgctctgt      1800
     gcaggcccgt attttcaggg aatagcggaa gaagcgctgc gcgacgtcgt tctggaagat      1860
     gtgcctcatc ggctcttcgc caagcgcagc caggccggag ccgaggaatt ggacgccgtg      1920
     gctctgttct gggacaaccc gggattgggg cacgaagaga acctgttgac agaaccctgc      1980
     tatccagagg actcgtga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page