(data stored in ACNUC7421 zone)

EMBL: CP001700.PE434

CP001700.PE434       Location/Qualifiers
FT   CDS_pept        487888..488886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0437"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: sco:SCO2449 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69389"
FT                   /db_xref="GOA:C7PVN3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN3"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACU69389.1"
FT                   /translation="MKDWWIFKGEGVPHRRVEQLPPPMASRSFGGAPLVELTLEEDRAA
FT                   VARLGRSEAEQRLLLSEPDLDLINAAILLRRPLLVTGKPGSGKSSLAYAIARELSLGPV
FT                   LHWSITSRTGVKEGLYGYDALGRLEETNLRRIMGADTAPDLGEYIRLGPLGTALLPQKH
FT                   PRVLLIDELDKSDLDLPNDLLHVFENGEFEIEEVVRQRGTDSVEVGVTGQPTPVTVHGG
FT                   LVRCNAFPIVVLTDNGERDFSAAFLRRCVRLKLADPDRDRLVGIVEAHLGEEGVRTGRT
FT                   LIEDFLVKRRAGTVATDQLLGAVYLAIAAKLGGTDRAELADRIMAPLDQVG"
     atgaaggact ggtggatctt caaaggtgaa ggagtccccc atcgtcgtgt cgagcagctg        60
     ccgccgccca tggcctcccg gagcttcgga ggagctccgt tggtcgagct cacgctcgag       120
     gaggaccggg cggcggtcgc gcggctgggg cggtccgagg ctgagcagcg tctccttttg       180
     tccgaacccg atctggactt gatcaacgcc gccatattgt tgcgcagacc cttgctcgtc       240
     acgggaaaac ccggcagcgg caagtcctcg ctggcctacg cgatcgcccg cgaactctcc       300
     ctgggaccgg tgctgcactg gtcgatcacc agccggaccg gcgtcaagga aggcctctac       360
     ggctacgacg cgctcggtcg gctggaggag acgaatctgc gccggatcat gggcgcggac       420
     accgctcccg acctcggtga gtacatacgc ctcggtccgc tcggaactgc cttgctgccg       480
     cagaagcacc cgcgtgtcct cttgatcgac gagctggaca agagcgatct cgatctgccc       540
     aatgacctgt tgcatgtctt cgagaacggc gagttcgaga tcgaggaggt ggtccggcag       600
     cgcggcaccg actccgtcga ggtcggcgtc accggccagc cgaccccggt cacggtgcac       660
     ggcggcctcg tgcgctgcaa cgcgttcccc atcgtcgtgc tcaccgacaa cggcgagcgc       720
     gacttctccg cggcgttcct gcgccgctgc gtccgcctca agctcgccga cccggatcgc       780
     gaccgcctgg tcggcatcgt cgaggcgcac ctgggcgagg aaggcgtgcg aaccgggcgc       840
     acgctgatcg aggacttcct ggtcaagcgc cgggccggca cggtcgcgac cgaccagctg       900
     ctcggcgccg tctacctggc gatcgcggcc aagctcggcg gcacggaccg ggccgagctg       960
     gccgaccgga tcatggctcc gctcgaccag gtggggtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page